KEGG   Nocardiopsis alba: B005_3035Help
Entry
B005_3035         CDS       T02218                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nal  Nocardiopsis alba
Pathway
nal00473  D-Alanine metabolism
nal00550  Peptidoglycan biosynthesis
nal01100  Metabolic pathways
nal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B005_3035 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B005_3035 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B005_3035 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nal01011]
    B005_3035 (ddl)
Enzymes [BR:nal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B005_3035 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:nal01011]
 Precursor biosynthesis
  Amino acid ligase
   B005_3035 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFR08262
UniProt: J7LCN6
LinkDB All DBs
Position
3163003..3164127
Genome map
AA seq 374 aa AA seqDB search
MSSEQRKIRIAVVFGGRSSEHEISCVTAGSVLSVIDPDRYEVVPVGITRTGNWVLASGDP
ENLRIDPATKALPSVSEDGLELALPFDTAGQLMTVSPSRGTERLAEVDVVLPLLHGPFGE
DGTIQGLFEMMGVRYAGAGVFSSAAAMDKVFMKAMLVGNGIPTSPYVAITARAWETERKK
VLDDIAELGTTVFVKPARAGSSVGISKVRDSGDADAVVAAVEAAREHDPKVLVEAQVVGR
EIECGVLESEDGGTPDVSFPAEVHVAEGFDFYDFEAKYLSTSGLTIPAEIPEEATARLRA
MAADVFEAMGCEGLARVDFFYTEDGEVLVNELNTMPGFTPSSAFPQMWEATGVDYATLVE
RMITTALRRSPGLR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgagcagcgcaagattcggatcgccgtcgtcttcggcggacgtagttccgaa
cacgagatctcctgcgtcaccgcgggcagcgtcctgtccgtcatcgaccccgaccgctat
gaggtcgtcccggtcgggatcacccgtaccggcaactgggtgctcgcgtcgggcgacccc
gagaacctgcgcatcgacccggccaccaaggcgctgccgagcgtctccgaggacggcctc
gagttggcgctgcccttcgacaccgccggacagctcatgaccgtgagcccgagccggggc
accgagcgcctggccgaggtggacgtggtcctgccgctgctgcacgggcccttcggtgag
gacggcaccatccaggggctgttcgagatgatgggcgtgcgctacgcgggagccggggtg
ttctccagcgccgccgccatggacaaggtgttcatgaaggccatgctggtcggcaacggc
atccccaccagcccctacgtcgccatcaccgcccgcgcctgggagaccgagcgcaagaag
gtgctggacgacatcgcggagctgggcacgacggtgttcgtcaagcccgcccgggcgggc
agcagcgtgggcatcagcaaggtgcgcgactccggtgacgccgacgcggtcgtcgccgcc
gtcgaggccgcccgcgagcacgacccgaaggtcctggtcgaggcgcaggtcgtcggccgt
gagatcgaatgcggagtcctggagtccgaggacggagggacccccgacgtctccttcccg
gccgaggtgcacgtggccgagggcttcgacttctacgacttcgaggccaagtacctgtcc
acgagcggtctgaccatccccgccgagattcctgaggaggccaccgcccgcctgcgcgcg
atggccgccgacgtcttcgaggcgatgggctgcgagggtctggcacgggtcgacttcttc
tacaccgaggacggcgaggtcctcgtcaacgagctcaacacgatgcccggcttcacgccg
tcgtcggccttcccgcagatgtgggaggccaccggcgtggactacgcgaccctggtcgag
cggatgatcaccaccgcgctgcgtcgctctcccgggctgcgctga

DBGET integrated database retrieval system