KEGG   Nocardiopsis alba: B005_3357Help
Entry
B005_3357         CDS       T02218                                 

Definition
(GenBank) histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
Organism
nal  Nocardiopsis alba
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AFR05813
UniProt: J7KWP4
LinkDB All DBs
Position
3495597..3498368
Genome map
AA seq 923 aa AA seqDB search
MEEQELGGVRTLVLRIRGPVAARGDGRRGPTETVEAFPRRSGRLAARDRSWPPMASSLVR
AVVRGRRQSAHLIRGDEIVAQAQSPHERDDLPLAKMMSTEDGRGARREGRFRRAISRMVK
SQEPPSPETEQGHPVHKPVHPHSHSPDRKSDGEETSATEPPTGPFSASAENGYRPTSRVS
VPNPYTTRRVEVDDVDTGANPVGQWRGVGLDEPEPRSKPTLATTDTMTETPSSPESTERP
EAPVPPTTEQRPTPGPSAPPVEPARLLAEPAQRTQPQPHHQPTEVAMPEASGAPRPEADR
PIPQGASAPSSYTGPSEPAYDPRGQEPPAHHPQQPAPQGPPPAYDPYAQQGHPFQGHVPP
GYGHQGQGYPARHEPAPYQPQRHEGHAPPAHYPSPYQQRVDYPVVPPYPAPQPAPYPHPL
VAYQNAYPAPYQPPGYVLPGQPVVYPGQFHPYGQPVQHVIVLSAGQQPQVITAESAATLF
AERSETTASEEVAQNKALTGSESVEESTDESRAKTEEETPSPSAAEDTDSSTEVASEKDE
IAKAKAEVAEAVSEVLRDSKGELLNEALAGLAMRDLSLVDALLEMVESLETDAQDPDLLD
KLFQIDNFATRMRRNGENLLVLTGHDGGESDAHDEIVPLLDVARAATSEIKDYPRVSLGK
LPQTSITGLAADDISHLLAELLDNATANSPEHSQVVISAQEMDDGRLMIIVEDEGVGIPE
AQLVELNSRLDGEPVLDDEVPKHMGLYVASRIAQKHGLETRLESRSFRGVSAYTIIPKDL
LRVATTRQPGQARTSTTPATNTPASRTVPQQPSYGGGANGTTGNGAGGNSGPKASPAASG
GNSSVTSAGLPRRSATPHGSPLRMMPHPGALSDNPPPPPKGREDTPPRLTGEARAEQIRD
ELGDFLDGERAALEGKDLEDGKE
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagcaggaattgggcggagtgcgtactcttgtccttcggatcaggggtccggtc
gccgctcgcggcgacggacgccgaggccccaccgaaaccgtcgaggcgttcccccgacga
tcgggacgcctggccgccagggaccgatcgtggcccccgatggcttcctccctggtcagg
gcggtggtgcggggccgccgccaatccgcccacctgattcgaggagacgagattgtggca
caggcgcagtcaccgcatgagcgcgatgacctccccctggccaagatgatgtcgacggag
gatgggcgtggagccaggcgtgaaggaaggttccgccgggccatctcccggatggtcaag
tcccaggaacccccgtcaccggagaccgagcaaggacatcccgtgcataagcccgtgcat
ccgcactcgcacagccccgaccggaagtcggacggcgaggagacatccgcgacggagccc
cccaccggacccttctccgcgtccgccgagaacggttaccgccccacatcccgggtgagc
gtaccgaatccctacacgaccaggcgggtcgaggtcgacgatgtcgacaccggcgccaat
ccggtcggtcagtggcgcggtgtcggcctcgacgagcccgaaccacgcagcaagcccacc
ctcgccaccacggacaccatgaccgagacgccctcctcaccagagagcacagagcggccc
gaggcccctgtgccccccacgaccgaacagcggccgacccccggcccgtccgcgcccccg
gtcgaacccgcgcggctcctcgccgagcccgcgcagcgaacgcagccccagccccaccac
cagcccacggaggtcgcgatgcccgaggcctccggcgcccctcgccccgaagcggaccgc
ccgatcccgcagggagcctccgcgccctcgtcctacacgggcccgagcgagcccgcgtac
gacccgcgcggccaagagccgccggcgcaccacccgcagcagccggcccctcagggcccg
ccgcccgcctacgacccctacgcccagcagggtcaccccttccaggggcacgtgcccccg
ggctacgggcaccagggccagggctacccggcccggcacgagccggccccctaccagccg
cagcggcacgagggccacgccccgcccgcgcactacccgtcgccctaccagcagagggtc
gactacccggtcgtgccgccctatcccgcgccgcagccggccccgtacccgcaccccctg
gtggcctaccagaacgcctacccggccccctaccagccgcccggctacgtccttccggga
cagccggtggtctacccggggcagttccacccctacggccagcccgtccagcacgtcatc
gtgctcagcgcgggccagcagccgcaggtgatcaccgcggagtcggccgccaccctcttc
gccgagcggagcgagaccacggcctccgaggaggtcgcccagaacaaggccctgaccggg
tcggagtcggtggaggagtccaccgacgagtcccgcgcgaagacggaggaggagacgccc
tccccgagcgcggccgaggacaccgactcctcgaccgaggtcgcttcggagaaggacgag
atcgccaaggccaaggccgaggtggccgaggccgtctccgaggtgctgcgcgactccaag
ggagagctgctcaacgaggcgctggccggactggccatgcgcgacctctccctggtggac
gccctgctggagatggtcgagtccctggagaccgacgcccaggacccggacctgctcgac
aagctgttccagatcgacaacttcgcgacccgtatgcgacgtaacggggagaacctcctg
gtgctgaccgggcacgacggtggagagtccgacgcgcacgacgagatcgtgcccctgctc
gacgtcgcacgcgccgcgacctcggagatcaaggactatcccagggtcagtctgggcaag
ctcccgcagacctccatcaccggtctggccgccgacgacatcagccacctgctcgccgag
ctcctggacaacgccaccgcgaactccccggagcactcccaggtggtgatcagcgcccag
gagatggacgacggtcgcctgatgatcatcgtcgaggacgagggcgtgggtatccccgag
gcccagctggtcgagctcaacagccgtctggacggcgagccggtcctggacgacgaggtg
cccaagcacatgggtctgtacgtggccagccggatcgcgcagaagcacggtctggagacc
cgcctggagtcccgctccttccgcggtgtcagcgcctacacgatcatccccaaggatctg
ctccgcgtggccacgacgagacagcccggccaggcccggacctccacgaccccggcgacc
aacacccccgcgagccgtaccgttccgcagcagccctcctacggaggcggcgcgaacggg
accaccggcaacggcgccggcggcaacagcggccccaaggcctctccggcggcctcgggc
gggaactcctcggtcacctccgcgggactgccccgtcgcagtgccacaccacacggttcc
ccgctgcggatgatgccgcaccccggggccctctccgacaacccgccgcccccgccgaag
ggccgggaggacacccctcccaggctcaccggcgaggcccgagccgaacagatccgcgac
gaactcggcgacttcctcgacggagaacgggcggccctcgaaggcaaggacctcgaggac
ggcaaggaatga

DBGET integrated database retrieval system