KEGG   Nocardiopsis alba: B005_3365Help
Entry
B005_3365         CDS       T02218                                 

Definition
(GenBank) short chain dehydrogenase family protein
Organism
nal  Nocardiopsis alba
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt PS-DH KR Ketoacyl-synt_C KAsynt_C_assoc PP-binding PikAIV_N Epimerase Thioesterase adh_short GDP_Man_Dehyd Polysacc_synt_2 adh_short_C2 Thiolase_N RmlD_sub_bind 3Beta_HSD ACP_syn_III NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AFR09809
UniProt: J7LFZ8
LinkDB All DBs
Position
3511276..3517422
Genome map
AA seq 2048 aa AA seqDB search
MHDTATGRPDSRVVEALRASIKDNERLREENRRLSEAASEPMAITAMSCRFPGGIDTPER
LWELLVDERETVSGFPTDREWDLRDLFDDDPDHHGHSYVRNASFLKDVADFDASFFGISP
KEATAMDPQQRLLLECAWEALERSGTDPTSLRGSRTGVFAGVIATEYGPRAVDTTDGSAG
HLVTGTAPSVSVGRISYILGLEGPAVSIDTACSSSLTALHTAVESLRRGECERALVGGVS
VVTDPSEFAGLSGQRALSPDGRSKAFDEAADGTGWSEGCGVLVIERLSDARRAGRPILAL
VRGCAVNQDGASSGLTAPNGSAQRKVIRQALENAGLEAADIDAAEAHGTGTPLGDPIEAE
ALINTYGRARTPDRPLLLGSLKSNIGHTVAAAGISGVIKMVLALRHGLLPRSLHLNTPTP
RVDWSAGTVVPLRRAHEWPREEGHVRRACVSSFGMSGTNAHAILEEAPLPNAAPEPAPER
TGPVAWPLSARGAEALAAQAARLADHVEAHPHLRPVDVGHTLATARADLPDRAVVVGSDT
DGLVEALRAVAEGTDHDSVVRGRVREQARTALVFPGQGSQWSGMAVPLMDSDPAFAARID
ECEKAFAAHVDWSLTDVLRGEPGAPGLDLIDVVQPVLFAVMVALADLWRRHGLRPSALIG
HSQGEIAAAHVAGALDLEDAALVVIARSRLLTSLVGKGAMAVLSISAEEAAERIRPWEAR
LGVAVVNGPATVVVAGDKDAVAELIETCESDGVHVRRIHDDVAGHSPHVDPLREDLLAAL
ADITPRPTRVPLYSTVTGERIEGTALNAEHWFENLRRTVLFEPGVRALHDAGFSAFVEVS
AHPVTTYGIQQTVEAAGDETTAVLSTLRRDQGTPTDALLALARAHVSGVAVDWAPLYDPY
RPGLVDLPTYAFQRDRFWSAPTRSADVSGSGVDPVSHPLLGAAVELPDDAGHLFTGLLSL
SEHPWLADHAVGSTVILPGAAHLDLVLHAAEHVGAGGVAELTLNAPLVLRPDEDVRVHVT
VGEADADGRRTVRVHGRAGGTWTEHAEGVLTPERPTPVVDQGVWPPSAAPLPVDDLYPRL
ASRGYGYGPVFQGLRAAWRDEDEVWAEVALPEGVAVDDHDVHPALLDASLHTIALLADED
DKVRLPFNWTGVTSHATGATSVRVHTARVGEDEYALTVTDGAGHLVLTADALEVRAVAAD
RIEESARRAESRELYALAWPALDLPTVPADTALTVLGEDPAGVADALTRVGLRTRSIGSL
DELTDDATVLVPCVSVSPDPEDLSGEARRALHRVLDLLQTWLADERTVDRRLVIVTRGAV
AVGEEGVDDVANAPLWGLLRSAQVEQPDRFVLVDLDPDLGEEGVALLPRALATGEPQMAL
RSEEARAPRFTAAEIPDEAAPSGFAGGRVLVTGATGVLGSALARHLAAHHGARDLLLLSR
RGEQSPGAADLRAELAGLGAQSTFVACDVTDSDALAEVIEAYPPTAVVHIAGTIDDGVLT
ALTPERIDTVLRPKADAAFHLHRLTRHLELTAFVLFSSAAGVLGSPGQANYAAANVFLDG
LVHHRRAQGLAGLSLGWGLWERLGESGSHLADTDISRLRRLGMARPLGHDEGLALLDAAL
AATDAHLVPMPLDLGAVRSRAARTGHLPPLFRGLVRPPRRKAAAIGSAGPDLRSLAGDDR
DRALLDLVGSRTLEVLGRSAGEELDPDQNFLELGMDSLTAVELRNELREATELRLPASVV
LNHATPRRLAAFLAAELPEHGAPATERPAAVGDPIEASVPLFREACVQGRVHDGLALIQA
AAHLRPTFDGPDDFGPLPRPVTVSRGPIGPRLVCLPSLVMVSGVQEYARFGAYFQGRREV
VVLPQPGFTPGDPLPATLEAAMELQARAVLEVAGDEPFVVVSRSSGGWTAHGVTTLLEAR
GRAPEAVVLMDTPMPDEPTAGPIIQAGVLERETRFGLMDGTRVTAMGRYMSLCADWEPRR
TEVPTLAVRPGGPMRTADGTRIGGDDWRFEWSLPHVAVDAEGDHISMLEEHGESTAALVH
AWIEEHTS
NT seq 6147 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaccgccaccggccgtcccgacagccgggtggtggaggccctacgcgcctcc
atcaaggacaacgaacgtctgcgcgaagagaaccggcggttgagcgaggccgcctccgaa
ccgatggccatcaccgcgatgagctgccgtttccccggtggtatcgacacaccggagcgg
ctatgggagctgttggtcgacgaacgcgagaccgtgtcgggttttcccaccgaccgtgaa
tgggacctgcgggacctgttcgacgacgatcccgaccaccacggccacagttacgtccgc
aacgcctccttcctcaaggacgtcgccgacttcgacgcctcgttcttcggtatctcgccg
aaggaggccacggccatggatccccagcagcggttgctgctggagtgcgcctgggaggcc
ctggaacgttccggcaccgacccgacgagcctgcgcggtagccgtaccggggtgttcgcc
ggggtcatcgccaccgagtacggtccccgggccgtggacaccaccgacggcagcgccggc
cacctggtcaccggtaccgcgcccagcgtctcggtgggccgcatctcctacatcctgggg
ctggaggggcccgcggtcagcatcgacaccgcctgttcctcctctctcaccgcactgcac
acggcggtggagtcgctgcgccggggcgagtgcgaacgagccctggtcggcggggtcagc
gtcgtcaccgacccctcggagttcgccggcctcagcggacagcgggcgctgagcccggac
gggcgcagcaaggccttcgacgaggccgcggacggcacgggctggagcgagggctgcggt
gtcctggtcatcgaacgcctctccgacgcccgccgcgccgggcgtccgatcctggccctg
gtgcgcggctgcgcggtcaaccaggacggtgcctccagcgggctgaccgcgcccaacggc
tccgcccagcgcaaggtcatccgacaggccctggagaacgccgggctggaggccgccgac
atcgacgccgccgaggcgcacggcaccggcacaccgctcggcgaccccatcgaggccgag
gcgctcatcaacacctatggccgggcccgcacccccgaccgtccactgctgctcggctcg
ctcaagtccaacatcgggcacaccgtcgccgccgccggtatctccggcgtgatcaagatg
gtgctcgccctccggcacgggctgctgccccgttccctccacctgaacacgcccactccg
cgcgtggactggtcggccggtaccgtcgtccctctgcgtcgggcccacgagtggccgcgc
gaagagggccacgtgcgccgcgcctgcgtttcctcgttcggcatgagcgggaccaacgcc
cacgccatccttgaagaggcacccctgccgaacgccgccccggaaccggcgcccgagcgg
acgggccccgtcgcctggccgctctcggcgcgcggcgccgaggccttggccgctcaggcc
gcgcgtctggccgaccacgtcgaggcccatccccacctgcggcccgtcgatgtcggtcac
accctcgccaccgcccgtgcggacctgcccgatcgcgccgtcgtcgtgggctccgacacc
gacggactggtcgaggccctgcgcgccgtcgccgaggggaccgaccacgactccgtggtg
cgcggccgtgtacgcgaacaggcccgtaccgccctggtcttccccggccagggctcccaa
tggagcggcatggcggtccccctcatggactccgacccggccttcgccgctcgtatcgac
gagtgcgagaaggccttcgcggcccatgtggactggtcgctcaccgacgtactgcgcggt
gagccgggggcgcccggcctggacctgatcgacgtcgtccagcccgtcctcttcgccgtc
atggtcgccctcgccgacctgtggcgacgtcacggcctgcgcccctcggcgctcatcgga
cactcccagggcgagatcgccgccgcgcacgtggccggggcgctcgacctggaggacgcc
gccctggtggtgatcgcccgcagcaggctgctcacctccctggtcggcaagggcgcgatg
gccgtactgtcgatctccgcggaggaggcggccgaacggatccgcccctgggaggctcga
ctcggcgttgccgtggtcaacggccccgccaccgtggtggtcgccggagacaaggacgcc
gtcgccgagctcatcgagacctgtgagtccgacggggtgcacgtccgtcgtatccacgac
gacgtcgccggtcactccccgcacgtcgaccccctgcgcgaggatcttctcgccgcgctc
gcggacatcaccccccgtccgacccgtgtcccgctctactccaccgtcacgggtgaacgc
atcgagggcaccgcgctgaacgcggagcactggttcgagaacctgcgccggaccgttctg
ttcgagccgggcgtccgcgccctgcacgatgccgggttcagtgcgttcgtcgaggtcagc
gcccaccccgtcaccacctacggaatccagcagaccgtggaggccgcgggggacgagacc
acggcggtcctgtcgaccctgcgccgagaccagggcacgcccaccgacgcgctcctggca
ctggcccgcgcgcacgtgagcggcgtggccgtggactgggctcccctgtacgacccgtac
cgtcccgggctggtcgacctgcccacctacgccttccaacgggaccgcttctggtcggcc
ccgacccgttccgcggacgtctccggcagcggcgtcgaccccgtctcgcatccgttgctg
ggcgcggccgtcgaactccccgacgacgccggacacctgttcaccgggctgctctccctg
agcgagcacccctggctggccgaccacgcggtgggcagcaccgtcatcctgcccggggcg
gcccatctggatctggtcctgcacgccgccgaacacgtcggcgccggcggggtggcggaa
ctgaccctcaacgcgcccttggtcctacggcccgacgaggacgtccgcgtccacgtcacc
gtcggagaagccgacgctgacggtcgtcgcacggtacgtgtgcacgggcgcgcgggcggg
acctggacggagcacgccgagggcgtgctcaccccggagcgacccacgcccgtcgtcgac
cagggggtgtggccgccctcggcggcgccgctgcccgtcgacgacctctatccgcgcctg
gcctcccgaggctacggctacggtcccgtcttccaagggttgcgcgcggcctggcgtgac
gaggacgaggtctgggcggaggtggcgcttcccgagggcgtcgccgtggacgatcacgac
gtccaccccgctctgctcgacgcctctctgcacaccatcgccctcctcgcggacgaggac
gacaaggtacggctgccgttcaactggaccggggtgacctcgcacgccacgggcgcgacc
tcggtacgtgtgcacaccgcccgtgtgggtgaggacgagtacgccctcaccgtcaccgac
ggcgcgggacacctggtgctgaccgccgacgcgctggaggtccgcgcggtcgccgccgac
cggatcgaggagagcgcccgccgcgcggagtcccgagagctttacgccctggcctggccc
gccctcgacctgcccaccgtgccggccgacaccgcgctcacggtcctgggagaggacccg
gccggggtcgccgacgccctgaccagggtggggctgcggacacgttcgatcgggagcctc
gacgagctgaccgacgacgccaccgtcctggtcccgtgcgtctccgtctcacctgacccc
gaggacctgtccggcgaggcgcgacgggccctgcaccgggtcctggatctgcttcagacc
tggctggccgacgaacgcaccgtcgatcggcggctcgtcatcgtcacccgcggagcggtc
gccgtcggtgaggagggggtcgacgacgtggcgaacgccccgctctgggggctgctcagg
tcggcacaggtggaacagcccgaccgtttcgtcctcgtcgacctcgaccccgatctcggg
gaggagggcgtcgccctgctgccgcgggccctcgccacgggggaaccgcagatggccctg
cgttccgaagaggctcgggcgccccggttcaccgccgccgagatccccgacgaggccgcc
ccgagcgggttcgccggcggtcgcgtcctggtcaccggcgccaccggtgtcctcggctcg
gcgctcgcccgccacctggcggcccaccacggcgcccgcgacctgctgctgctgagccgt
cgtggtgaacagagccccggcgcggccgacctgcgcgccgaactcgccggactcggagcc
cagagcactttcgtggcctgcgacgtcaccgattccgacgcgctggccgaggtcatcgag
gcgtatccgcccacggcggtggtgcacatcgccggcaccatcgacgacggcgtgctcacg
gccctgacccccgaacggatcgacaccgtcctgcgtcccaaggccgacgccgccttccac
ctgcaccgactcacccgacacctggagctgacggccttcgtgctgttctcctccgccgcc
ggtgtgctgggcagcccgggacaggccaactacgccgcggccaacgtcttcctcgacgga
ctggtccaccaccgtcgcgcccaagggctggccggcctctctctgggctggggcctttgg
gagcggctgggcgagtcaggatcccacctggccgacaccgacatctcccgactgcgtcgc
ctgggcatggcccgtcctctcggccacgacgaagggctcgccctactcgacgccgcgctg
gccgcgaccgacgcccacctcgtaccgatgccgctcgacctgggggccgtgcgttcccgg
gccgcccgtaccggtcaccttccgccgctgttccgcggactggtccggcccccgcgtcgc
aaggccgccgcgatcggttcggccggccccgacctgcgctccctcgccggggacgaccgg
gatcgggcgctgctcgacctggtcggctcacgcaccctggaggtcttgggacggtccgct
ggcgaagagctcgaccccgaccagaacttcctcgaactgggcatggactcgttgaccgcc
gtggaactgcgcaacgagctgagggaagccaccgaactgcgccttcccgcctcggtggtg
ctcaaccacgccaccccccgacgtctggccgcgttcctggccgccgaactccccgagcac
ggagcgccggccaccgaacggccggccgccgtcggcgacccgatcgaggcctcggtcccg
ctgttccgcgaggcctgcgtgcagggacgcgtccacgatgggctcgccctcatccaggcc
gcggcgcatctgcggcccaccttcgacggccccgacgacttcggtcccctgccccggccc
gtcaccgtctcccgaggcccgatcgggcctcgactggtgtgcctgccgtcgctggtgatg
gtctccggggtccaggagtacgcccgcttcggcgcctacttccagggacgacgcgaggtc
gtggtactgccccagcccggcttcaccccgggcgacccgttgcccgcgacgctggaggcc
gccatggaactccaggcccgcgccgtcctggaggtggcgggcgacgaaccgttcgtcgtg
gtcagccgttcctcgggtggatggaccgcgcacggggtcaccaccctcttggaggcccga
ggccgggcgcccgaagcggtcgtgctcatggacacccccatgccggacgaaccgaccgcc
gggcccatcatccaggccggggtgctcgaacgcgagacccgcttcgggctgatggacggc
acccgggtcaccgccatgggccgctacatgagcctgtgcgccgactgggaacctcggcgc
accgaggtgcccaccctggcggtgcgcccgggcggtcccatgcgcaccgccgacgggacc
cgcatcggcggcgacgactggcggttcgagtggtccctgccgcacgtcgccgtcgacgcc
gagggcgaccacatcagcatgctggaggagcacggcgagagcaccgccgcgctcgttcac
gcctggatcgaggagcacacctcgtaa

DBGET integrated database retrieval system