KEGG   Nocardiopsis alba: B005_4653Help
Entry
B005_4653         CDS       T02218                                 

Definition
(GenBank) amino acid permease family protein
  KO
K11735  GABA permease
Organism
nal  Nocardiopsis alba
Brite
KEGG Orthology (KO) [BR:nal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nal02000]
    B005_4653
Transporters [BR:nal02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   B005_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease Trp_Tyr_perm
Motif
Other DBs
NCBI-ProteinID: AFR10666
UniProt: J7LD99
LinkDB All DBs
Position
4872753..4874156
Genome map
AA seq 467 aa AA seqDB search
MTLIAIGGSVGAGLFVGSGAVIQTAGPAAVLSYALAGALVFLTLRALGEMVVSVPAGGSF
SDYARLAFGPRAGFAIGWVYWWMYAVLVAAESVAGATILAQWVDLPGWVLALTVLLAMTV
ANLISVRVFAETESLFSLIKVATIVAFLLVGGLYALGLWSGSQGSTVSNLWDLGGFAPNG
WVAVLGATVVVLFAFGGVEIITIAAGESSEPERGVASAVTNVLWRIGLFYVASILVVVMV
VPWNSSDLDRSPFVVVMETVGIPGAALIMEIVVLIAVLSVLNAAMYTSSRMLFMLTRQGD
APAVLRGTNRRGVPVRAILLGTVVGYAAVVADYVAPGQVFHFLVASIGAILLVLFLTICA
SQLVVGARVRRRAPERLTLRMWAFPYLTWATLLGLVGIFVAMATLPQHREALWASVGAVV
VALVAYEGRRRWGRSVPSRLVLGVRERATPEELERIAGKGGSSPAGG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgatcgcgatcggcggttcggtgggtgccgggctgttcgtggggtcgggcgcg
gtgatccagaccgcggggccggcggcggtgttgtcctacgcgttggcgggcgccctggtg
ttcttgaccctgcgggccttgggcgagatggtcgtgtcggttccggccggtgggagtttc
tccgactacgcgcggttggcgttcgggcccagggcgggtttcgccatcgggtgggtctat
tggtggatgtacgcggtgttggtggcggccgagtcggtggccggggccacgatcctggcc
cagtgggtggatctgcccggttgggttttggcgttgacggttctgttggcgatgacggtg
gccaatctgatctcggtgcgggtcttcgctgagacggagtcgttgttctcgctgatcaag
gtcgccacgatcgtggcgttcttgctggtgggcggcttgtacgcgttgggtctgtggagt
ggttcgcaagggtcgacggtgtcgaacctgtgggatctgggcgggttcgcccccaatggc
tgggtcgcggtgttgggtgccacggtggtggtgttgttcgccttcggtggggtggagatc
atcacgatcgcggcgggtgagagttccgagcccgagcggggggtggcctcggcggtcacc
aacgtgctgtggcggatcgggttgttctacgtggcctccatcctggtggtggtgatggtg
gtgccgtggaactcctccgatctggaccggagtccgttcgtggtggtcatggagacggtg
ggtatcccgggcgcggcgttgatcatggagatcgtggtgttgatcgcggtgttgagcgtg
ttgaacgccgcgatgtacacctcgtcgcggatgttgttcatgctcacccgtcagggggac
gctccggcggtgttgcggggcacgaatcggcgtggtgtgccggtgcgggcgatcctgttg
ggcaccgtggtggggtacgcggcggtggtcgccgactatgtggcgccgggtcaggtgttc
catttcctggtggcctcgatcggcgcgatcctgttggtgttgttcttgacgatctgcgct
tcgcagttggtggtgggtgcgcgggtgcgtcgtcgggcgccggagcggttgacgttgcgg
atgtgggcgttcccgtatctgacgtgggcgacgttgttgggtctggtggggatcttcgtg
gcgatggcgacgttgccgcagcatcgtgaggcgctgtgggcgtcggtgggtgccgtggtg
gtggcgttggtggcctatgaggggcgtcgtcgttggggtcggagcgtgccgagtcgtctg
gtgttgggtgtgcgtgagcgtgccacgcccgaggagttggagcggatcgcgggtaagggg
ggctcctcccccgcgggtgggtga

DBGET integrated database retrieval system