KEGG   Nocardiopsis alba: B005_5150Help
Entry
B005_5150         CDS       T02218                                 

Definition
(GenBank) catalase family protein
  KO
K03781  catalase [EC:1.11.1.6]
Organism
nal  Nocardiopsis alba
Pathway
nal00380  Tryptophan metabolism
nal00630  Glyoxylate and dicarboxylate metabolism
nal01110  Biosynthesis of secondary metabolites
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B005_5150
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    B005_5150
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     B005_5150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AFR09255
UniProt: J7LCW6
LinkDB All DBs
Position
complement(5340348..5342438)
Genome map
AA seq 696 aa AA seqDB search
MADAERDAKDRQLDAERTESRGPLTTETGVRVEDTDNSLSVGERGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGHFTPYEDLSDLTAAHFLSGPDVTTPVFVRFSTVAGSRGSA
DTVRDVRGFAVKFYTEQGNYDLVGNNMPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSAH
DTLWDFVGLQPETTHMIMWLMSDRAIPRSYRTMQGFGVHTFRFVDERGRGTFVKFHWRPI
LGTHSLVWDEAQRIQGKDPDYNRRDLWEAIERGQYPEWELGVQLVPEENEHDFSFDLLDA
TKIIPEEQVPVRPIGRMVLNRNPDNFFAETEQIAFHTANVVPGIDFTNDPLLQARNFSYL
DTQLLRLGGSNFQQIPVNRPVARVDNNQRDGFAQHRVHRGGTSYYPNSLGGGCPALADEN
VYRHYTEKVEGNKIRRRAESFKDHYSQARLFLNSLADWEREHLVAAFRFELGKCEELSIR
QRVVANLVEVDHGLAVAVAEGIGVEPPEDPGTRGHENSSPALSQANTAFGDLTGRQVAVL
LSDGVDGDAVEAIRDALVAKGAVVELLARADGSVRTRDGGDLALDRSYTTVSSVLYDAVA
IPGGADSVDALEEDGEARHFVLEAYKHNKTIAALGQGTALLTGTGVSGQLATPPLETVTH
EGVVRSPAVDTEFIEEFARLIGLHRHWERPTGAVSA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgccgaacgtgacgccaaggaccggcagctcgacgcggagcgcacggagtcg
cgaggaccgctgaccaccgagaccggggtcagggtcgaggacaccgacaactccctgagc
gtcggtgagcgcggaccgacgctgctggaggacttccacgcccgggagaagatcacccac
ttcgaccacgaacgcatccccgagagggtggtccacgcaaggggagcgggcgcctacgga
cacttcacgccctacgaggacctgtccgacctcaccgccgcgcacttcctgagcggcccc
gacgtcaccaccccggtcttcgtccgcttctccacggtggccggttcacgcggctcggcc
gacacggtgcgcgacgtacgcggtttcgcggtcaagttctacaccgaacagggcaactac
gacctggtcggcaacaacatgccggtcttcttcatccaggacgggatcaagttccccgac
ttcgtgcacgcggtcaaacccgaaccgcacaacgagatcccccaggcacaatcggcccac
gacaccctgtgggacttcgtggggctgcaaccggagaccacccacatgatcatgtggctg
atgtcggaccgggcgatcccgcgcagctaccgcaccatgcagggcttcggcgtccacacc
ttccgattcgtcgacgagcgggggcggggcaccttcgtcaagttccactggaggccgatc
ctggggacccactctctggtgtgggacgaggcccagcgcatccagggcaaggaccccgac
tacaatcgccgcgacctgtgggaggccatcgaacgcggccagtaccccgaatgggaactg
ggggtgcagctggtgcccgaggagaacgagcacgacttctcattcgacctgctggacgcc
acgaagatcatccccgaggagcaggtgcccgtacggcccatcggtcggatggtcctgaac
cgcaacccggacaacttcttcgccgagaccgagcagatcgccttccacaccgccaacgtg
gtcccggggatcgacttcaccaacgatcccctgctccaggcccgcaacttttcctacctg
gacacgcagctgctgcggctgggcggctccaacttccagcagatccccgtcaaccgaccg
gtggccagggtcgacaacaaccagcgtgacggcttcgcccagcaccgcgtgcaccggggc
gggacctcctactacccgaactcgctgggcggcggctgcccggccctggccgacgagaac
gtgtaccgccactacacggagaaggtcgaggggaacaagatccgccgccgggcggagagc
ttcaaggaccactactcccaggcccggctgttcctcaacagcctcgccgactgggagagg
gagcacctggtggcggccttccgcttcgaactgggcaagtgcgaggagctctcgatccgg
cagcgggtggtggccaacctggtggaggtggaccacgggctcgccgtcgccgtcgccgag
gggatcggggtggaaccacccgaggacccagggacgcgagggcacgagaactcctcgccc
gcgctcagccaggcgaacacggccttcggcgacctgaccggccgccaggtggcggtgctc
ttgagcgacggggtggacggcgacgccgtcgaggcgatcagggacgccctcgtggcgaag
ggcgcggtggtcgaactcctcgcgcgcgccgacggatccgtgcggacccgggacggagga
gacctggcgctggaccgttcctacacgaccgtctcctcggtcctgtacgacgcggtggcg
atccccggcggcgcggactcggtcgacgccctggaggaggacggggaggcccggcacttc
gtgctggaggcctataagcacaacaagacgatcgcggccctcggccaggggacggcgctg
ctcacgggcacgggggtgtccggtcagctggccaccccgccgttggagacggtgacccac
gaaggggtggtgcgctcgcccgcggtggacacggagttcatcgaggagttcgcgcgactc
atcgggctgcaccgtcactgggagcggcccacgggcgccgtctcggcctga

DBGET integrated database retrieval system