KEGG   Nautilia profundicola: NAMH_0945Help
Entry
NAMH_0945         CDS       T00860                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nam  Nautilia profundicola
Pathway
nam00473  D-Alanine metabolism
nam00550  Peptidoglycan biosynthesis
nam01100  Metabolic pathways
nam01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NAMH_0945
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NAMH_0945
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NAMH_0945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nam01011]
    NAMH_0945
Enzymes [BR:nam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NAMH_0945
Peptidoglycan biosynthesis and degradation proteins [BR:nam01011]
 Precursor biosynthesis
  Amino acid ligase
   NAMH_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACM93621
UniProt: B9L9N9
LinkDB All DBs
Position
complement(862975..864009)
Genome map
AA seq 344 aa AA seqDB search
MTFALLFGGNSFEHEISIVSAITLKDKIKKHTLEFIYIDQNRNMYLVDKQNMKSKYFASG
EYKNSQKIEITKGGFKYTKGLLKKDVFLNYDAVINLIHGKDGEDGKLAGILEFFNIKSIT
PNVEASVISYNKVLTKAYAKEIGVNVIDYEIITEPKSSFDFPIIIKPARLGSSIGVSVVK
TQEEFDYAFDVAREFDDLIIAEPFIEGIEEYNLAGCLAGGEFMLSNIEKVEKSDFLDFEK
KYMDFSRKNVMLSDVDKDLTERIKKTFKKIYNSTFKNAIIRCDFFVKEGSVYLNEINPIP
GSMANYLFDDFDDVLEKLAKNIESEKEVKIDFEYINKIQMAKGK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgctttgcttttcggcggaaacagctttgaacacgaaatttcgatagtaagt
gctattacacttaaagacaaaataaaaaaacatacgttagaatttatatatattgaccaa
aacagaaatatgtatcttgtagataaacaaaacatgaaaagcaaatattttgcaagcgga
gaatataaaaactctcaaaaaatcgaaattacaaaaggaggatttaaatacacaaaaggg
cttttgaaaaaagatgtgtttttaaattatgatgcggttattaatcttattcacggtaaa
gatggtgaagacggaaaacttgcgggaattttagagttttttaacataaagtcaattact
ccaaatgtagaagcaagcgttataagctataataaagttttaactaaagcatacgccaaa
gaaataggggtaaatgtaatagattatgaaataatcacggagcctaaaagcagctttgac
ttcccgattattataaagcctgcgcgccttggaagcagtatcggtgttagtgtagtcaaa
acacaagaagagtttgactatgcttttgacgtggcgagggagtttgatgatttaattatt
gcagaaccttttatagaaggaatagaagaatataaccttgcgggatgtctggccggaggg
gagtttatgcttagcaatattgaaaaagtcgaaaaatcagactttttggactttgagaag
aaatatatggacttcagcagaaagaatgttatgttaagtgatgttgataaagaccttact
gagagaattaaaaaaacttttaaaaaaatctataatagtacttttaaaaatgcgattatc
aggtgcgatttttttgtaaaagagggtagtgtatatttaaatgaaataaatccgatacct
ggtagtatggcgaattatctctttgatgattttgatgatgttttggaaaaacttgctaaa
aatattgaatcggaaaaagaagttaaaattgattttgaatatatcaataaaatccaaatg
gctaaaggaaaataa

DBGET integrated database retrieval system