KEGG   Nautilia profundicola: NAMH_1461Help
Entry
NAMH_1461         CDS       T00860                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase, catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
nam  Nautilia profundicola
Pathway
nam00230  Purine metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01130  Biosynthesis of antibiotics
Module
nam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NAMH_1461 (purE)
Enzymes [BR:nam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     NAMH_1461 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC DAGK_cat PrpR_N DHQ_synthase Fe-ADH_2 Saccharop_dh_N
Motif
Other DBs
NCBI-ProteinID: ACM93560
UniProt: B9L665
LinkDB All DBs
Position
complement(1367239..1367736)
Genome map
AA seq 165 aa AA seqDB search
MRFISILMGSKSDYEIMREAVKILEKFQIPYELIITSAHRTPDRTHSYVKEAEERGCKVF
ICGAGMAAHLAGVVASLTTRPVIGVPMPTGMMDGLDALLSTVQMPGGMPVATLAVGKAGA
KNAAYLALQILANNDDELKAKLEEDRVAGAKKVEMDSKEVEVRID
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagatttatatcaatacttatgggaagcaagagcgattatgagattatgagagaagct
gttaagattttggaaaaattccaaattccttatgagctgattatcacatcggcacacaga
acgccagacagaactcacagctatgtaaaagaagctgaagagagaggttgtaaagtgttt
atttgcggtgccgggatggcggctcaccttgcaggtgtggttgcatcacttactacaagg
ccggtgattggtgttcctatgcctacgggtatgatggacggacttgacgcacttttaagt
actgttcaaatgccgggaggtatgcctgttgcaactttagctgtaggaaaagccggagct
aaaaacgcggcgtatcttgcgcttcagattttagcaaataatgatgacgaacttaaagcc
aaacttgaagaagacagggttgcgggagctaaaaaagtagagatggattctaaagaagta
gaagtaagaatagactga

DBGET integrated database retrieval system