KEGG   Natronolimnobius sp. AArc1: AArc1_0796Help
Entry
AArc1_0796        CDS       T05614                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nan  Natronolimnobius sp. AArc1
Pathway
nan00564  Glycerophospholipid metabolism
nan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AArc1_0796
Enzymes [BR:nan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AArc1_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 FAD_binding_3 FAD_binding_2 Pyr_redox Thi4 DAO_C NAD_binding_8 Lycopene_cycl Pyr_redox_3 3HCDH_N DUF3606 YbjQ_1 ApbA HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AXR77138
UniProt: A0A346PC93
LinkDB All DBs
Position
complement(781471..783141)
Genome map
AA seq 556 aa AA seqDB search
MATDTDVLVLGGGSTGCGIARDLAMRGLEVTLLERGTLTDGTTGRMHGLLHSGGRYAVSD
QASARECIEENRILREIAGHCVEETGGLFVKRPEDSDAYFQEKLEGCRECDIPATVLSGR
EAREIEPYLATDVERAIEVPDAAVDPFRLCVANAMDATAHGARIETHAEVIDLLRDGDDV
FGVTVRHGAGPGKRTDVPTGTVEEITADYVVNATGAWAGAIAGMADLEVEVRPSKGVMTI
MNVRQVDTVINRCRPKGDADIIVPHETTAILGTTDEEVDDPDDYPEERWEVDAMIDTLAE
LVPILREARTIRSFWGVRPLYEPPETGTTDPTDITREFFLLDHADRDGVSGITSIVGGKL
TTYRAMAEAISDHVCAELGVNASCETADEPLPGSERLETLEAAMDEFGLRSPVARRSSQR
LGSRTREVLERYDPNPVICQCEGVTRAEVQDAIAQSGSDLNAVRIRTRASMGNCQGGFCC
QELACELHPAYDAETVRDAFDELFEERWKGQRHALWGEQLSQAMLTYALHTTTMNRDGDP
AGDSQAIDYAAFDGGR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggacaccgacgtcctcgtcctcggtgggggatcgaccggctgtggtatcgcc
cgagatctggcgatgcgcggcctcgaggtcaccctcctcgagcggggaacgctaacagac
gggacgaccggccggatgcacggcctgctccacagcggtggccggtacgccgtctcagat
caggcgagcgcgagagagtgcatcgaagagaaccgtatccttcgggagatcgcgggccac
tgcgtcgaggagaccggcgggctgttcgtcaagcgcccggaagattcggacgcatacttc
caggaaaaactcgagggctgtcgtgagtgtgatatcccggcgacggtcctttcgggccgt
gaagcccgcgagatcgaaccctatctcgcgacggacgtcgagcgagcgatcgaggttccc
gacgcggcggtcgacccgtttcgcctgtgcgtcgcgaacgcgatggatgcgacagcccac
ggcgcacgtatcgagactcacgcggaggtgatcgacctcctgagggacggcgacgatgtc
ttcggcgtcaccgtccgccacggcgctggccccggcaagcgaaccgacgtgccgaccgga
acggtcgaggagatcaccgccgactacgtcgtcaacgcgacgggcgcgtgggccggagcg
atcgctgggatggccgacctcgaggtcgaggtccgtccctcgaagggcgtgatgacgatc
atgaacgtccggcaggtcgacaccgtcatcaaccgctgtcgcccgaaaggtgacgcagac
atcatcgtcccccacgagacgacggcgatcctcggcacgaccgacgaggaggtcgacgac
cccgacgactaccccgaagaacgctgggaggtcgacgcgatgatcgacacgctcgcagaa
ctcgtccccatcctccgggaggcccggacgatccggtcgttctggggggttcgaccgctg
tacgagccgccggaaaccggcaccacggacccgaccgacatcacgcgcgagttcttcttg
ctcgatcacgccgaccgggacggcgtctcgggcatcacgagcatcgtcggcgggaagctg
accacctaccgcgcgatggccgaagcgatttccgaccacgtctgtgccgaactcggcgtg
aacgcctcgtgtgaaaccgcggacgaaccgctgcccggcagcgagcgcctcgagacgctc
gaggcggcgatggacgagttcgggcttcggtcgccggtcgcccgccggtccagccagcga
cttggcagtcggactcgggaggtactcgagcgctacgaccccaatccggtcatctgccag
tgtgagggtgtgacccgcgcggaagtgcaggacgcaatcgcccagtcggggtcggacctg
aacgcggttcgaattcgaacgcgggcctcgatgggcaactgccagggtggcttttgctgt
caggaactggcctgtgaactccatcccgcgtacgacgccgaaaccgtccgcgacgcgttc
gacgaactgttcgaagagcgctggaagggccagcgccacgccctctggggagaacagctc
tcgcaggccatgctcacctacgcgttgcacacgacgacgatgaaccgcgacggcgatccc
gcgggcgactcgcaggcgatcgactacgcggccttcgacggagggcggtga

DBGET integrated database retrieval system