KEGG   Nitrospirillum amazonense: Y958_02985Help
Entry
Y958_02985        CDS       T04935                                 

Definition
(GenBank) cellulose synthase
Organism
nao  Nitrospirillum amazonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Glyco_hydro_17 Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: ASG19909
UniProt: A0A248JMP2
LinkDB All DBs
Position
1:complement(638660..641248)
Genome map
AA seq 862 aa AA seqDB search
MQKSAWAVLLLLVLGNIGAWAIVNRPAVERPWAGTIAGVAFVPFQANQTPQNGDSPTADD
IKRDLDVVAPHVQSIRTYQVGNGIDQVAPIALERYPNLTITQGAWLSKDPAANEAELAGL
VRVARANANVKRVMVGNEVLFRDDFSVAQLIDYIQRVKRQVNVPVSTAEPSYVWLDHPEL
ADACDFITIHLLPYWNKVSVDRAVEDAMAAYRQVQERFPNKHILIGETGWPSDGAYRGAA
EAGLVNEAKYIRSFLNIAGQQRLDFYIMEAFDQPWKRTLGGTAETAWGIWDAHRHQKFPM
VGGILEVPSWRVLCAIATALAFFPMFFFVLARDDLKWRGQLFYGFLIQTVASVLVWTGTQ
ALTVGMGTLSFTAFMVLILAQLILFAVMLIDGLELTEVVWTQRWKRRYTPVREPLGDYTP
KVSIHVPCYNEPAHMVIETLDALAAMDYPNFEVLVIDNNTKDEAVWRPLEEYCAKLGPRF
RFFHLPRWPGFKGGALNFGLSVTAPDVEVVGVIDSDYQVTPDWLSATIPYFKRPEVGFVQ
SPQDYRDWSDDAFKSMINWEYQGFFHIGMIQRNERNAIIQHGTMTLVRKSALDGVGRWAE
WCICEDSELGLRLFEEKLEAVYMPDSFGQGLVPDSFAGYKTQRFRWAYGAVQILKRHWRE
MMPGGTKLTAGQKYHFITGWLPWFADAAHMGFVIGGIVWSLGLLLLPQWIEFPPTVFILP
TLSVFFFKVLCGLWLYGERVKCRFIDKLGAAIAGMALTHTVGRAVWVGLFTSGRPFVRTP
KCEDQPALIQGFLHAREEVGLMLGLWLAAAAIALLKGSDNRDAYVWATMLVVQSFPYIAA
LFLSTLNALPKSGGAEATAPAE
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatccgcctgggcggtcctgcttcttctggtgctgggcaacatcggcgcatgg
gcgatcgtcaatcgcccggccgtggagcgcccgtgggccggcaccatcgccggcgtggcc
ttcgtgcccttccaggccaaccagaccccgcagaacggcgacagccccaccgccgatgac
atcaagcgcgacctggacgtggtggcgccgcatgtgcagtccatccgcacctaccaggtg
ggcaacggcatcgaccaggtggcgcccatcgccctggagcgctatcccaacctgaccatc
acccagggcgcctggctgtccaaggacccggccgccaatgaggcggaactggcgggcctg
gtgcgcgtggcgcgcgccaacgccaacgtgaagcgggtcatggtcggcaacgaggtgctg
ttccgcgacgatttcagcgtcgcccagctgatcgactacatccagcgcgtgaagcgccag
gtgaacgtgccggtgtcgacggccgagccgtcctacgtctggctggaccatccggaactg
gcggatgcctgcgacttcatcaccatccacctgctgccctattggaacaaggtgtcggtg
gaccgcgcggtggaggacgccatggcggcctaccgccaggtgcaggagcgcttccccaac
aagcacatcctgatcggcgagaccggttggccgtccgacggcgcctatcgcggggcggcc
gaggccgggctggtgaacgaggccaagtacatccgcagcttcctgaacatcgccggccag
cagcgcctggacttctacatcatggaggccttcgaccagccgtggaagcgcacactgggc
ggcacggcggagacggcctggggcatctgggacgcgcaccgccaccagaagttccccatg
gtgggcggcatcctggaggtgccgtcgtggcgggtgctgtgcgccatcgccaccgccctg
gccttcttccccatgttcttcttcgtgctggcccgcgacgatctgaaatggcgcggccag
ctgttctacggcttcctgatccagacggtggcctcggtcctggtatggacgggcacccag
gccctgaccgtgggcatgggcaccctgtccttcaccgccttcatggtgctgatcctcgcc
cagctgatcctgttcgccgtcatgctgatcgacggcctggaattgacggaggtggtgtgg
acccagcgatggaagcggcgctacacgcccgtgcgtgagccgctgggcgactacacgccc
aaggtttccatccatgtcccctgctataacgaaccggcgcacatggtgatcgagaccctg
gacgcgctggcggccatggactaccccaacttcgaagttctggtgattgacaacaacacc
aaggacgaggcggtgtggcgcccgctggaggaatactgcgccaagctggggccgcgcttc
cgcttcttccacctgccgcgctggccgggcttcaagggcggcgccctgaacttcggtctg
tccgtcaccgccccggacgttgaggtggtgggcgtcatcgacagcgactaccaggtcacg
cccgactggctgtcggccaccatcccctatttcaagcggccggaggtgggcttcgtccag
tcgccgcaggactaccgcgactggtccgacgacgccttcaagtcgatgatcaattgggaa
taccagggctttttccacatcggcatgatccagcgcaacgagcgcaacgccatcatccag
cacggcaccatgaccctggtgcgcaagagcgccctggatggcgtgggccgctgggccgag
tggtgcatctgcgaggattcggaactgggcctgcgcctgttcgaggagaagctggaggct
gtctacatgcccgacagcttcggccagggcttggtccccgacagcttcgccggctacaag
acccagcgcttccgctgggcctatggcgccgtgcagatcctgaagcgccactggcgcgag
atgatgccgggcggcaccaagctgaccgccgggcaaaagtaccacttcatcaccggctgg
ctgccctggttcgccgacgccgcccacatgggcttcgtcatcggcggcatcgtctggtcg
ctgggcctgctgctgctgccgcagtggattgagttcccgcccaccgtcttcatcctgccc
accctcagcgtcttcttcttcaaggtgctgtgcggcctttggctgtatggggagcgggtg
aagtgccgcttcatcgataagctgggcgcggccatcgccggcatggcgctgacccatacc
gtgggccgcgccgtgtgggtgggtctgttcaccagcggccgccccttcgtacgcacgccc
aagtgcgaggaccagccggccctgatccagggcttcctgcacgcgcgggaggaggtgggg
ctgatgctcggcctgtggctggccgccgccgccatcgccctgctgaagggcagcgacaac
cgcgacgcctacgtctgggccaccatgctggtcgtccagtccttcccctacatcgcggcc
ctgttcctcagcaccctgaacgccctgcccaagagcggtggcgccgaggccaccgccccg
gcggaatga

DBGET integrated database retrieval system