KEGG   Nitrospirillum amazonense: Y958_13945Help
Entry
Y958_13945        CDS       T04935                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00630  Glyoxylate and dicarboxylate metabolism
nao01100  Metabolic pathways
nao01120  Microbial metabolism in diverse environments
nao01200  Carbon metabolism
Module
nao_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nao_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Y958_13945 (rbcL)
Enzymes [BR:nao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Y958_13945 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N Cas_Csx9
Motif
Other DBs
NCBI-ProteinID: ASG22083
UniProt: A0A248JTM8
LinkDB All DBs
Position
2:complement(97489..98946)
Genome map
AA seq 485 aa AA seqDB search
MNAIDKRDRRDRYAAGVMKYQDMGYWQPDYVPKDTDVIAVFRITPQDGVDPIEAAAAVAG
ESSTATWTVVWTDRLTACDKYRAKAHRVEPVPGSPESWFAYIAYDIDLFEPGSIANLTAS
IIGNVFGFKPLKALRLEDMRLPVAYVKTFDGPPTGIVVERERLDKFGRPLLGATVKPKLG
LSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNRAQAVTGEIKGTY
LNVTAATMEDMYERAEFAKSIGSCIVMIDLVIGYTAIQSMSKWARRNDMVLHLHRAGHST
YTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPATTKGYYDICREDFLPQRLEN
GIFFDQSFASLRKTMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGATAN
RVALEAMVLARNEGRDIVNEGPDILAAASRHCTPLRQALDVWKDVTFNYTSTDAPDFVPT
ASVAG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcgacaagcgggaccgccgcgaccgttacgccgccggggtcatgaagtac
caagacatgggctactggcaaccggactacgtgcccaaggacacggacgtcatcgccgtc
ttccgcatcacgccacaggatggggtggatcccatcgaggcggcggcggccgtggccggc
gagtcctccaccgccacctggacggtggtgtggaccgaccggctgacggcctgcgacaag
tatcgcgccaaggcgcacagggtggaaccggtgcccggatcgcccgagagctggttcgcc
tacatcgcctatgacatcgatcttttcgaacccggatcgatcgccaatctgacggcatcc
atcatcggcaacgtcttcggcttcaagccgctgaaggccctgcggctggaggacatgcgc
ctgccggtggcctatgtgaagaccttcgacgggccgcccaccggcatcgttgtggagcgg
gaacggctggacaagttcggccgccccctgctgggcgccacagtgaagcccaagctgggc
ctgtcggggcgcaactacggccgcgtggtctatgaggcgctgaagggcggcctggacttc
accaaggatgacgagaacatcaattcccagcccttcatgcactggcgcgaccgcttcctc
tattgcatggaggcggtgaaccgcgcccaggcggtgacgggcgagatcaagggcacctac
ctgaacgtgaccgccgccaccatggaggacatgtacgagcgggcggagttcgccaaatcc
atcggctcgtgcatcgtcatgatcgacctggtcatcggctacaccgccatccagtccatg
tccaaatgggcgcggcgcaacgacatggtgctgcacctgcaccgcgcggggcattccacc
tacacccggcagaagagccacggcgtgtccttccgcgtcatcgccaagtggatgcggctg
gcgggggtggaccacatccacgccggcacggtggtgggcaagctggagggcgaccccgcc
accaccaagggctattacgacatttgccgcgaggacttcctgccccagcggctggagaac
ggcatcttcttcgaccagtccttcgcctcgctgcgcaagaccatgccggtggcctcgggc
ggcatccatgccgggcagatgcaccagctgctggacctctttggcgatgacgtggtgctg
cagttcggcggcggcaccatcggccaccccatgggcatccaggctggcgccaccgccaac
cgggtggcgctggaggccatggtgctggcccgcaacgagggccgcgacatcgtcaacgaa
ggcccggacatcctggccgccgccagccgccactgcacgcccctgcgccaggccttggac
gtctggaaggacgtgaccttcaactacacctcgaccgacgcgccggactttgtgccgacc
gccagcgttgctggctaa

DBGET integrated database retrieval system