KEGG   Nitrospirillum amazonense: Y958_14670Help
Entry
Y958_14670        CDS       T04935                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nao  Nitrospirillum amazonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASG23512
UniProt: A0A248JXR8
LinkDB All DBs
Position
2:complement(262564..264045)
Genome map
AA seq 493 aa AA seqDB search
MTHPTLVNLRHPDCLFIGGDWVSPLSGAKLDIVSPSTERLVGCVAEAGPADMDRAVAAAR
QAFDTGPWPRTTGLERAAFLRAMADRLEARADDFAHAWALQVGIPLPQAQMSARLARGYF
DYYAGLAAEGFEEVRTPARGGTCVVVREPVGVAAAVVPWNAPLATLLLKVAPALAAGCAI
IAKPAPETPLEALLLAECAEAAGLPPGILSVVPSQREAADHLIRHEGVDKVSFTGSTAAG
RHIAAVCAGRMTRVALELGGKSAAIVLDDAPIETILGGVLPTLIGLCGQQCAAFSRILVP
RHRLTNITEAMAAAFQAVQVGDPFVSGTQMGPLVAKRQLERVQSFIDQGRRDGATLVTGG
TRPAHLERGWFIAPTLFTRVDNSMPLAREEIFGPVGSIIAYDSEDEAVAIANDSPYGLSG
GVFTQDTDRAYAIARRVRTGNFSQNGRVIDYTLPYGGFKQSGMGREGGIEGLHGFTEVKA
VFLPHAPSHLITR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgactcatcccacgctggtgaacctgcgccaccccgattgccttttcatcggcggcgac
tgggtcagccccctgtccggcgccaagctggacatcgtgtcgccatcgacggaacgactg
gtgggatgcgtggccgaggcggggccggctgacatggaccgcgccgtggccgccgcccgc
caagccttcgatactggcccctggccccgcacgaccgggctggaacgcgccgcgtttctg
agggccatggccgaccggctggaggctcgggccgatgacttcgcccatgcctgggccctg
caggtcggcatccccttgccccaggcccagatgtccgcgcgcctggcccgaggctacttc
gactattacgccggcctggcggcggaaggcttcgaggaagtgcgcacgccggcccgtggc
ggcacctgcgtggtggtgcgggagcccgtgggcgtggccgccgccgtcgtcccctggaac
gccccgctggcgaccctgctgctgaaggtcgcgccagcgctggcggctggctgcgccatc
atcgccaagccggccccggaaacgccgctggaagcgttgctgttggccgagtgcgcggag
gcggccggcctgccgcccggcatcctgtcggtcgtgccttcccaacgcgaggccgccgac
catctgatccggcatgagggtgtcgacaaggtcagcttcaccggctcgacagccgccggc
cgccacatcgccgccgtctgcgccggccgcatgacccgcgtcgccctggaattgggcggc
aagtccgccgccatcgtgctggacgacgcccctatcgagacgatcctcggcggtgtcctg
cccacgctgatcggcctgtgtggccagcaatgcgccgccttcagccgcatcctggtgccg
cgccaccgcctgaccaacatcaccgaggccatggccgccgcctttcaggccgtccaagtg
ggcgatcccttcgtctcgggcacacagatgggccccctggtcgccaagcggcagttggag
cgcgtgcagagcttcatcgaccagggacgacgcgatggcgccacgctggtgaccggcggc
acccgtcccgcccacctggagcgcggctggtttatcgcgcccaccctgttcacccgtgtg
gacaattccatgcccctggcccgggaggagatcttcggcccggtgggcagcatcatcgcc
tacgacagcgaggacgaggccgtcgccatcgccaacgacagcccctacggcctgtccggc
ggcgtgttcacccaggacacggaccgggcctatgccatcgcccgccgcgtgcgtaccggc
aacttcagccaaaacgggcgggtcatcgactacaccctgccctatggcggcttcaagcaa
tcaggcatgggccgcgaaggcggcatcgagggtttgcacggcttcaccgaggtcaaggcc
gtcttcctgccccatgccccctcccacctgatcacccgctga

DBGET integrated database retrieval system