KEGG   Nitrospirillum amazonense: Y958_16995Help
Entry
Y958_16995        CDS       T04935                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00473  D-Alanine metabolism
nao01100  Metabolic pathways
nao01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Y958_16995 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Y958_16995 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nao01011]
    Y958_16995 (alr)
Enzymes [BR:nao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Y958_16995 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:nao01011]
 Precursor biosynthesis
  Racemase
   Y958_16995 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C zf-HC2
Motif
Other DBs
NCBI-ProteinID: ASG22619
UniProt: A0A248JVJ7
LinkDB All DBs
Position
2:complement(819403..820653)
Genome map
AA seq 416 aa AA seqDB search
MASSPASPTSTPTTPWPVPATITEEPGVSSVDFPSQVPVGAGAVLAIDLDAIAGNWRVLR
DHAQRTGRAVECAGVVKADGYGLGAVPVATALAEAGCRSFFVADLEEAAALRAVLSPGTF
SGARVLVLHGPTAGTEREMAALGLTPVLNSLDDIARWRATAVELGRALPAFIHIDTGMNR
LGLDDRDARHLAAEPALLTGLTLAGWMSHLASADVAGDGLAAEQDARLRAHLARLPRAPA
SLAASSGIFREPALLHDLVRPGAALYGVNPTPEAPNPMAPALRLLGRILQVREVPAGATV
GYGATYRTTAPARLATIAVGYADGYCRALGSSGHVTIAGVRAPVVGRISMDLLSVDATRV
PPEALVPGAFAELIGPDRPLDDVAADAGTIGYEILTGLGRRFCRVYQGAWPVAAHP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttcacccgcttctccgacctcgacacccaccacgccctggccggtgccggcg
acgattactgaggagccgggggtgtcgtccgtggatttcccgagccaggtgccggtcggc
gccggtgccgtcctggccatcgacctggatgccattgcgggcaactggcgcgtcctgcgc
gaccatgcccagcggaccggccgcgcggtcgaatgcgccggcgtggtcaaggccgacggc
tatggcctgggtgccgtgccggtggccacggccctggccgaggccggctgccgcagcttt
ttcgtcgccgatctggaggaggccgccgccctgcgcgcggtgttgtcccctggcaccttc
tccggcgcgcgcgtcctggtcctgcacggccccacggcgggcacggagcgggagatggca
gccctgggcctgacgcccgtcctgaacagcctggacgacatcgcccgctggcgggccacg
gcggtggagcttggccgcgccctgcccgccttcatccatatcgacacgggcatgaaccgc
ctgggcctggacgaccgcgacgcgcggcatctggccgcggagcccgccctgctgaccggc
ctcacgctggcggggtggatgagccacctggccagcgccgacgtggccggcgacggcctc
gccgccgagcaggacgcccgcctccgggcgcacctggcccgactgccccgggcgccggcc
agcctggccgcctcctccggcatcttccgggagccggcgctgctgcacgacctagtccgg
ccgggggcagcgctgtacggcgtgaacccgacgccggaggcacccaaccccatggcgccg
gcgctgcgcctgctgggccgcatcctgcaggtgcgggaggtgccggccggggccacggtg
ggttatggcgcgacatatcgcaccacggcgccggcgcgcctggccaccatcgcggtgggt
tacgccgacggctactgccgggccctgggctcctccgggcatgtcaccatcgccggcgta
cgcgcccccgtggtggggcgcatatccatggatctgctgagcgtggatgcgacgcgggtc
cccccggaagccctggttcccggcgccttcgccgagctgatcggtcccgatcggccgttg
gacgacgtggccgcggatgccggcaccatcggctatgagatcctaacagggcttggccgg
aggttttgccgcgtgtatcagggggcatggcctgttgcggcgcacccgtga

DBGET integrated database retrieval system