KEGG   Nitrospirillum amazonense: Y958_17290Help
Entry
Y958_17290        CDS       T04935                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00970  Aminoacyl-tRNA biosynthesis
nao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nao00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Y958_17290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nao03029]
    Y958_17290
Enzymes [BR:nao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Y958_17290
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Y958_17290
Mitochondrial biogenesis [BR:nao03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Y958_17290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASG22672
UniProt: A0A248JVD6
LinkDB All DBs
Position
2:886071..887555
Genome map
AA seq 494 aa AA seqDB search
MTKLTHLTMADALAGLAAKEFTAVELTQAHLDAMAATKELNAYIIETPDVALKQAADADA
RYAKGEQRALDGLPLGIKDLFCTEGVQTTAASHILDGFVPPYESTVTTQLFRDGAVMLGK
LNLDEFAMGSANITSHYGPVISPWSPKDEAGNFTRKLVPGGSSGGSAAAVAARLALGATG
TDTGGSIRQPASFVGIVGIKPTYGRCSRWGIVAFASSLDQAGPMTRTVKDAALMLRSMAG
YDPKDSTSIDVPVPDYAAALTGDIRGLRVGIPKEYRVDGMPAEIEKLWQQGIEWLKAAGA
TPVEISLPHTKYALPAYYIVAPAEASSNLARYDGVRFGLRVEGKDLKEMYENTRAEGFGA
EVKRRIMIGTYVLSAGYYDAYYLKAQKVRARIAEDFTKAYELCDVILTPTAPSAAFGIGE
KMDDPIAMYLNDVFTVPANLAGLPGLSVPAGLSGEGLPLGLQVLGRPFDEATVLKVGHVI
EQAAGPQPLPPLVS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctgacccacctgaccatggccgatgccttggccggcctggccgccaaggag
ttcaccgccgtcgagctgacccaggcgcacctggacgccatggcggcgaccaaggagctg
aacgcctacatcatcgagacgccggacgtggcgctgaagcaggcggccgacgccgacgcc
cgctacgccaagggcgagcagcgggccctggacggcctgcccctgggcatcaaggacctg
ttctgcaccgagggcgtgcagaccacggccgccagccacatcctggacggcttcgtcccg
ccgtatgagagcacggtcaccacccagctgttccgcgacggcgccgtcatgctgggcaag
ctgaacctggatgaattcgccatgggctcggccaacatcaccagccactacggcccggtg
atcagcccgtggtcgcccaaggacgaagccggtaacttcacccgcaagctggtgcccggc
ggttcctcgggtggctctgccgccgccgtggccgcgcgcctggcgctgggcgccaccggt
accgacaccggtggttccatccgccagccggccagcttcgtcggcatcgtcggtatcaag
cccacctatggccgctgctcgcgctggggcatcgtcgccttcgcctcgtccctggaccag
gccggccccatgacccgcacggtgaaggacgcggcgctcatgctgcgctccatggccggt
tacgaccccaaggacagcacctccatcgatgtgccggtgccggactacgccgccgccctg
accggcgacatccgcggcctgcgcgtgggcattcccaaggaataccgcgtcgatggcatg
ccggcggagatcgagaagctgtggcagcagggcatcgaatggctgaaggccgccggcgcc
acgccggttgagatcagcctgccgcacaccaagtacgccctgccggcctactacattgtc
gccccggctgaggcctcctccaacctggcccgttatgacggcgtgcgtttcggcctgcgc
gtcgagggcaaggacctgaaggagatgtatgagaatacccgcgccgagggcttcggcgcc
gaggtgaagcgccgcatcatgatcggcacctacgtgctgtcggccggctactacgacgcc
tattacctgaaggcgcagaaggtgcgggcccgcatcgccgaggacttcaccaaggcgtac
gagctgtgcgacgtcatcctgacgcccaccgccccgtcggccgccttcggcatcggcgag
aagatggacgatcccatcgccatgtacctgaacgacgtcttcaccgttcccgccaacctg
gcgggcctgcccggtctgtcggtgccggccggcctcagcggcgagggcctgcccctgggc
ttgcaggtgctgggccgtccgttcgatgaagccaccgtgttgaaggtcggccacgtcatc
gaacaggccgccggcccgcagcccctcccgccgctggtgtcgtaa

DBGET integrated database retrieval system