KEGG   Nitrospirillum amazonense: Y958_19920Help
Entry
Y958_19920        CDS       T04935                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nao  Nitrospirillum amazonense
Brite
KEGG Orthology (KO) [BR:nao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Y958_19920
Enzymes [BR:nao01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Y958_19920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 FMO-like NAD_binding_8 Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ASG23121
UniProt: A0A248JXA1
LinkDB All DBs
Position
2:complement(1518003..1519565)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKTQLKAYLERVKQPIEIVAYPDDSATSRQMMELLADIAEASTLVNINENVDGAG
RRPSFTVNRPAGDIGIRFSGLPMGHEFTSLVLALLQAGGYPPKVSDEVIAQIKAIEGDYH
FETFISLTCHNCPDVVQALNLMAVLNPRIRHEMIDGGVFQDEVTRRQIMGVPAIFLNGEP
FGQGRMELEEILAKLDTSSVAREAAKIDAKDPFDVLVVGGGPAGAAAAIYAARKGIRTGI
VAERFGGQVMDTLGIENFISVTATEGPKLVRSLEEHVRTYEVDIMNQQRAKALATVDGLH
EVTLESGAKLKAKALILATGARWREMKVPGEEQYKTKGVAFCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVAHVTLLEFDSQLRADAVLVTKLKSLANVTILTQAQTTEVTGDGNK
VNGLVYKDRTTGETHRLALEGIFVQIGLLPNTDWLRGTVELTQRGEVIVGHHGETSVPGI
FAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRSSVQAA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctcaagacccaattgaaggcctatctggaacgggtgaagcagccg
atcgagattgttgcttacccggacgatagcgccacctcccgccagatgatggagctgctg
gccgacatcgccgaagcctccaccctggtgaacatcaacgagaacgtggatggcgccggc
cgccgcccgtccttcaccgtcaatcgcccggccggcgacatcggcatccgcttcagcggc
ctgcccatgggccacgagttcacctcgctggtgctggcgctgctgcaggccggcggctat
ccgcccaaggtcagcgacgaggtcatcgcgcagatcaaggccatcgagggcgattaccac
ttcgagaccttcatctcgctgacctgccacaactgcccggacgtggtgcaggccctgaac
ctgatggcggtgctgaacccccgcatccgccatgagatgatcgatggtggcgtcttccag
gatgaggtgacccggcgccagatcatgggcgtgccggccatcttcctgaacggcgagccc
ttcggccagggccgcatggagctggaggagatcctggcgaagctggacaccagctccgtc
gcccgcgaggccgccaagatcgacgccaaggaccccttcgacgtgctggtggtgggcggt
ggccccgccggtgccgcggccgccatctatgccgcccgcaagggcatccgcaccggcatc
gtggccgagcgcttcggcggccaggtcatggacacgctgggcatcgagaacttcatctcc
gtcaccgcgacggaagggccgaagctggtccgcagcttggaagagcatgtccgcacctat
gaggtggacatcatgaaccagcagcgcgccaaggccctggccacggtcgacggcctgcac
gaagtgacgctggaaagcggcgccaagctgaaggccaaggccctgatcctggccaccggc
gcacggtggcgcgagatgaaggtgccgggcgaggaacagtacaagacaaagggcgttgcc
ttctgcccgcactgcgacggccccctgttcaagggcaagcgcgtggcggtgatcggcggc
ggcaactccggcgtcgaggcggccatcgatctggccggcatcgtcgcccatgtcacgctg
ctggagttcgacagccagctgcgcgccgacgcggtgctggtgaccaagctgaaaagcctg
gccaacgtcaccatcctgacccaggcccagaccaccgaggtcacgggcgacggcaacaag
gtgaacggcctggtctacaaggaccgcaccacgggcgagacgcaccgcttggcgctggag
ggcatcttcgtgcagatcggcctgctgcccaatacggactggctgcgcggcacggtggaa
ctgacccagcgcggcgaggtgatcgtcggccaccatggtgaaacctccgtccccggcatc
ttcgccgccggcgacgtcaccacggtgccctacaagcagatcatcatcgccatgggcgag
ggggccaaggcctccctgggcgccttcgaccacctgatccgctcctcggtccaggccgcc
tga

DBGET integrated database retrieval system