KEGG   Nitrospirillum amazonense: Y958_27450Help
Entry
Y958_27450        CDS       T04935                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00500  Starch and sucrose metabolism
nao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y958_27450
Enzymes [BR:nao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Y958_27450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ASG24595
UniProt: A0A248K0U2
LinkDB All DBs
Position
3:complement(1369495..1371876)
Genome map
AA seq 793 aa AA seqDB search
MTNNKTMGRKRAAALMAMLLASSMTGAAFAAVAPGAPGQAATGAYAGKTGIGTAYHAYDA
QAGKAVPSRVWFSLAKGVVTETMYGLIHEVQLRELKLAIQGDGFLDVEDKDTDSTTSYLD
VDAAGRPRSLAYKVVNKARNGKYEIEKQVFTDPAADTLVVRVTVRAKGGTVTPFLLVDPQ
MAGTGGGDKADVVDGALHAYEGDRHLVVKAAPGFKTASVGFVGASDGLTQLQKAGKLEGS
YTTTGDKAGNVALAGALAPVTGEATFDIVVGFGDSAKAADAAATATLKRGHDAVQAAYDA
GWEGYQAKLAPLPDLAKVAMDGGKLLYASALVLKAQEDKTHPGALIASLSAPWGDTQKAD
KPATGYKAVWPRDFYQCAMALLALGDSETPKAALTYLKTIQVGPKTPGNHGDGGWFLQKT
HVDGTPEWVGVQLDQTAMPLMLAWRLWRNGVISDADVTALYTSMVKPAADFLVKGGTAGI
GWNKATIRPPVTQQERWEEQAGNSPSTTAAVIAGLAAAAELAGQAGDEASVKRYYAAADT
YSAGLEAATVTTNGQLAPKGSKAGYYLRIAPTGQPNARTPLAVRNGQQALTEDAYVDGGF
LELVRYGVRAPSDPVIKASLAVLDDETLPENLRVKYTFHFAGDPTAYPGWRRYGNDGYGE
DRATGANYAVSGSMTPTQRGRVWPLLTGERGHYELALAAAKAGGAKPAEVEAIRATYVRA
MERFANQGLMIPEQVWDGVGSDGGRGYKAGAGTDSATPLAWAHAEYVKLLRSLHDGGVWD
LYAPVAVRYATKP
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaataagacgatgggacggaaacgggcggccgcgctgatggcgatgctgctg
gcctccagcatgacgggggccgctttcgccgccgtggcgccgggtgcgccggggcaggcg
gcgacgggcgcctacgcgggcaagacgggcatcggcacagcgtatcacgcctacgatgcg
caagcgggcaaggcggtgccgtcgcgcgtctggttctcgctggccaagggggtggtcacg
gaaaccatgtacggcctgatccatgaggtgcagctgcgcgagctgaagctcgccatccag
ggcgacggcttcctggatgtggaggacaaggataccgacagcaccaccagctatctggat
gtcgatgccgccggccgtccccgctcgctggcctacaaggtcgtgaacaaggccaggaac
ggcaagtacgagatcgagaaacaggtcttcaccgaccccgccgccgacacgctggtggtg
cgcgtgacggtgcgggccaagggcggtacggtcaccccctttctgctggtggacccgcag
atggccggcaccggtggcggcgacaaggccgatgtggtcgacggcgccctgcacgcctat
gagggcgaccgccatctggtggtgaaggccgccccgggcttcaagaccgccagcgtgggc
ttcgtcggcgcttccgacgggctgacccagttgcaaaaggccggcaagctggagggcagc
tacaccaccaccggcgacaaggccggcaacgtggccctggcgggcgccctggcgcccgtg
acgggggaagcaaccttcgacatcgtcgtcggcttcggcgacagcgccaaggcggcggac
gccgccgccacggccacgctgaagcgcgggcacgacgctgtgcaggcggcgtatgatgcc
ggctgggaaggataccaggccaagctggcgcccttgccggacctggctaaggtcgccatg
gatggcggcaagctattgtacgccagtgccctggtgctgaaggcgcaggaggataagacc
catcctggcgcgctgatcgcgtcgctgtccgcgccctggggcgacacgcagaaggcggac
aagccggcgacgggctacaaggcggtgtggccgcgcgacttctaccagtgcgccatggcc
ctgctggccctgggcgacagcgagacgcccaaggcggcgctgacctacctgaagaccatc
caggtgggaccgaagacgcccggcaaccatggcgacggcggctggttcctgcagaagacg
catgtggacggcacgccggaatgggtgggcgtgcagttggatcagaccgccatgccgctg
atgctggcctggcgcctgtggcgcaacggcgtcatcagcgacgccgatgtcacggcgctc
tacaccagcatggtgaagccggccgccgacttcctggtcaagggcggtaccgccggcatc
ggctggaacaaggccaccatccgcccgcccgtaacccagcaggaacgctgggaggagcag
gccggcaactccccctccaccacggcggcggtcatcgccggcttggcggcggcggctgaa
ctggcgggccaggcgggggatgaggcgtcggtgaagcgctactacgccgctgccgacacc
tattccgccgggctggaggccgcgacggtcaccaccaacggccagctggcgccgaaagga
tcgaaagcggggtattacctgcgcatcgcgcccaccgggcagcccaacgcccgcacgccc
ctggcggtgcggaacggacagcaggcgctgacggaggatgcctatgtcgacggcggcttc
ctggagctggtgcgctatggtgtgcgggcgcccagcgaccccgtcatcaaggccagcctg
gccgtcctggatgacgagacgctgccggagaacctgcgcgtcaagtataccttccacttt
gccggcgaccccacggcctatcccggctggcgccgctacggcaacgacggctatggcgag
gaccgggcgaccggcgccaactacgccgtcagcggcagcatgacccccacccagcgcggc
cgcgtctggcccttgctgacgggggagcgcgggcattacgagctggcgctggcggcggcc
aaggccggcggcgccaagccggcggaggtggaggccatccgcgccacctacgtccgcgct
atggagcgcttcgccaaccagggcctgatgatcccggaacaggtgtgggatggcgttggc
agcgacggcggccgcggctacaaggccggtgccggcaccgacagcgcgacgccgctggcc
tgggcgcatgctgagtatgtgaagttgctgcgctccctgcacgacggcggggtctgggac
ctctacgcccccgtggcggtgcgctacgcgaccaagccgtaa

DBGET integrated database retrieval system