KEGG   Nautilia sp. PV-1: C3L23_00195Help
Entry
C3L23_00195       CDS       T05986                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nap  Nautilia sp. PV-1
Pathway
nap00061  Fatty acid biosynthesis
nap00780  Biotin metabolism
nap01100  Metabolic pathways
nap01212  Fatty acid metabolism
Module
nap_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C3L23_00195 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C3L23_00195 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nap01004]
    C3L23_00195 (fabZ)
Enzymes [BR:nap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C3L23_00195 (fabZ)
Lipid biosynthesis proteins [BR:nap01004]
 Fatty acid synthase
  Component type
   C3L23_00195 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AZV45752
UniProt: A0A3T0KZR9
LinkDB All DBs
Position
38298..38738
Genome map
AA seq 146 aa AA seqDB search
MVYDINQIQEMLPHRYPFLLVDRITDVKEGEYVEGYLNISITNQVFQGHFPGHPIYPGVL
IIEGMAQTGAILPFTVMSKEDLNDKVVYFMSIDKAKFRKPVLPGDKLVYKISTIKHRGKI
WQLKGEAYVDGELVSEAELKAMIMDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgatattaatcagattcaggaaatgttacctcacagatatccgtttttgtta
gttgacagaattacggatgtaaaagagggcgaatatgttgaggggtatttgaatatttct
attacaaatcaggtatttcagggtcacttcccggggcatcctatttatccgggcgtgtta
atcattgaaggtatggctcagactggagctattttaccttttacagtaatgagcaaagaa
gacttaaacgataaagttgtatattttatgagcattgacaaagcgaaattcagaaagccg
gtgcttccgggggataaactcgtatataaaatttctactatcaagcacagaggtaaaata
tggcagcttaagggtgaagcgtatgttgacggagagcttgtaagcgaagctgaacttaaa
gccatgataatggacaaatga

DBGET integrated database retrieval system