Nautilia sp. PV-1: C3L23_01025 Help Entry C3L23_01025       CDS       T05986                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nap  Nautilia sp. PV-1 Pathway nap00790   Folate biosynthesis nap01100   Metabolic pathways nap01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:nap00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     C3L23_01025 Enzymes [BR:nap01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      C3L23_01025  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      C3L23_01025  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      C3L23_01025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AZV45897 UniProt:  A0A3T0KZX2 LinkDB All DBs Position 181081..181422 Genome browser AA seq 113 aa AA seqDB search MRIENNYKILIENLEFKAIIGILPEEREKTQKVLVHAEIEYEGKNNYIDYAEVCDLIEKL MIERKFLLIEDAMEAIEAKLLEKYPQMKSLELHIKKPEILRNALVGVKILRKY NT seq 342 nt NT seq  +upstreamnt  +downstreamnt ttgagaattgagaataattataaaatattaattgaaaatttggaatttaaggctataatc ggaatattgcccgaagagagggaaaaaacgcaaaaagttttagtacatgcggaaattgaa tatgaaggcaaaaacaattatatagattatgccgaagtatgcgatttaattgaaaaactt atgattgagaggaaatttctgcttatagaagacgccatggaggctatagaagctaaactt ctggagaaatatcctcagatgaaaagccttgaacttcatataaaaaaacctgaaatttta agaaatgctttagtgggagtgaaaatcttaagaaaatattaa

DBGET integrated database retrieval system