KEGG   Novosphingobium aromaticivorans: Saro_1136Help
Entry
Saro_1136         CDS       T00322                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00473  D-Alanine metabolism
nar00550  Peptidoglycan biosynthesis
nar01100  Metabolic pathways
nar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Saro_1136
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Saro_1136
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Saro_1136
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nar01011]
    Saro_1136
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Saro_1136
Peptidoglycan biosynthesis and degradation proteins [BR:nar01011]
 Precursor biosynthesis
  Amino acid ligase
   Saro_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ABD25581
UniProt: Q2G992
LinkDB All DBs
Position
1182477..1183418
Genome map
AA seq 313 aa AA seqDB search
MSLPKLHVAVLMGGWSSERPVSLMSGEGVAKALESKGHQVTRIDMDRDVALRLAEAKPDV
VFNALHGTPGEDGSIQGLMDIMGLTYTHSGLVTSVIAIDKELTKQALVPHGIPMPGGRMV
KTADLYKADPLPRPYVLKPVNEGSSVGVAIVTAEGNYGSPISAASKGPWQEFDQLLAEPF
IRGRELTTAVIGDRALLVTELRPKSGFYDFDAKYTEGMTDHICPAEIPDEITEACKDIAL
RAHRLLGCKGTSRSDFRWDDEQGVEGLFLLEVNTQPGMTPLSLVPEQARALGMDYSDLVE
AIIAEALKDAGKA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgcccaaacttcacgttgcagtcctcatgggtggctggtccagcgaacgcccc
gtgtcgctcatgtccggcgagggcgtggccaaggctcttgaatcgaaggggcaccaagtc
acgcgcatcgacatggaccgcgacgtcgcactgcgcctggccgaggcgaagcctgacgtc
gtgttcaatgccctgcacggcaccccgggcgaggatggttcgatccagggcctgatggac
atcatgggcctgacctatacccactccggcctggtcacctcggtcatcgcgatcgataag
gaactgaccaagcaggcgctggtgccacatggcatcccgatgcccggcgggcgcatggtc
aagacggctgacctctacaaggccgatccgctgccgcgcccctatgtgctgaagcccgtc
aacgaagggtcatcggtcggggtcgcgatcgtcactgccgagggcaattacggcagcccg
atcagcgcggcgagcaagggcccgtggcaggaattcgaccagctcctcgccgaacccttc
atccgcgggcgcgagctgacgaccgccgtgatcggcgaccgcgcgcttctggtcaccgaa
cttcgtccgaagtccggcttctacgacttcgacgccaagtacaccgagggcatgaccgac
cacatctgtcccgccgagattcccgacgagatcaccgaggcgtgcaaggacattgcgctg
cgggcccacaggttgctcggctgcaaggggaccagtcgttccgacttccgctgggatgac
gagcagggcgtcgagggactgttcctgctggaagtgaacacccagccgggcatgacgccg
ctcagcctcgtgccggaacaggcgcgggcgctcggcatggattattccgatctggtggag
gcgatcatcgccgaagccctgaaggacgcaggaaaggcctga

DBGET integrated database retrieval system