KEGG   Novosphingobium aromaticivorans: Saro_2801Help
Entry
Saro_2801         CDS       T00322                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh HCV_NS4a
Motif
Other DBs
NCBI-ProteinID: ABD27237
UniProt: Q2G4I6
LinkDB All DBs
Position
complement(3024456..3025925)
Genome map
AA seq 489 aa AA seqDB search
MTPEGVNVAHPDKLYIAGRWVPAHSGRMIELVSPNTELVVGRVAEADETDMDAAVAAARD
AFDHGPWPTTPPAERIAAFRRMVAHLETRVPELAKAWTAQMGGLASFAGPMHGGSVMALG
QIAGFAEKFEFVERRPSMAADTALIAYEPVGVVAAIAPWNGPFGIMANKVAYALLTGCTV
IMKPSPETPLEAYIIAEAAEAAGIPAGVVNLVTGHREASDHLVCNEGVDKVSFTGSTVAG
KRIASVCGSRMARCTLELGGKSAAIVRDDFPIDAAAKMLAGTITMMSGQVCAMLSRVIVP
RRRHDELAEAIAAEMKKVRIGNSDDPETQLGPVAMKRQLERIEMYIEEGRKTADLVTGGG
RPAHLNRGYFIEPTLFANVRNESRIAQEEIFGPVLSLIPVEDEEDAIRTANASAYGLNGS
VLTNDAEAAYRIARRVRTGGFGQNGLRMDFGLPFGGFKQSGIGREGGPEGLFPYLEMKTI
LIDGMPSAL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgaaggcgtgaacgtagcccatcccgacaagctctacatcgccggccgctgg
gtgccggcgcattcggggcggatgatcgaactggtctcgcccaacaccgagctggtggtg
ggccgggttgccgaagccgacgagacggacatggacgccgccgttgccgccgcgcgtgat
gccttcgatcacgggccatggccaaccacgcctccggccgagcgcatcgccgcattccgg
cgaatggtcgcgcaccttgaaacgcgcgtgcccgaactggcgaaggcgtggaccgcgcag
atgggcgggctcgcctcgttcgcggggccgatgcacggcggcagcgtgatggcgctgggc
cagattgcggggtttgcggaaaagttcgagttcgtcgagcgccgcccgagcatggccgcc
gataccgcgctgatcgcctatgagccggttggggtcgtggcagcgatcgcgccgtggaac
gggccgttcgggatcatggcgaacaaggtcgcctatgccctgctgaccggctgcacggtg
atcatgaagccgtcgcccgaaacgccgctggaagcctatatcatcgccgaggcggccgag
gcggctggtattccggccggcgtcgtcaatcttgtgacgggacaccgcgaggcgagcgat
caccttgtctgtaacgaaggcgtcgacaaggtgagtttcaccggatcgaccgtggccggc
aagcgcatcgccagcgtttgcggttcgcgcatggcgcgctgcacgctggaactgggcggc
aagtcggcagccatcgtgcgggacgatttccccatcgatgccgccgcgaagatgctggcg
gggacgatcacgatgatgtcgggccaggtctgtgcgatgctcagccgggtcatcgttccg
cgccgccgtcacgatgaactcgccgaggcgatcgcggcggaaatgaagaaggtgcgcata
ggcaattccgacgatcccgagacccagctcggcccggtcgcgatgaagcggcagctcgaa
cggatagagatgtatatcgaggagggccggaagacggccgatctcgtcaccggcggcgga
cgcccggcccatctgaatcgcggctacttcatcgagcccacgcttttcgccaacgtcagg
aacgagagccgcatcgcgcaggaggagattttcggccctgtcctcagcctgatcccggtc
gaggacgaggaggacgccatccgcaccgccaatgccagcgcatatggcctcaacggatcg
gtcctgaccaacgatgccgaagccgcctatcgcatcgcccggcgcgtgcgcaccgggggc
ttcggtcagaacgggctgcgcatggacttcggcctgcccttcggcgggttcaagcaatcc
ggcatcggccgcgaaggcgggccggaagggctcttcccctatctcgaaatgaagaccatc
ctgattgatggcatgccttcggcgctttga

DBGET integrated database retrieval system