KEGG   Novosphingobium aromaticivorans: Saro_3080Help
Entry
Saro_3080         CDS       T00322                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Saro_3080
Enzymes [BR:nar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Saro_3080
Transporters [BR:nar02000]
 Other Transporters
  Pores ion channels [TC:1]
   Saro_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABD27515
UniProt: Q2G3Q8
LinkDB All DBs
Position
3298573..3299244
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLLLSEKGVAYDLVRENPWERREGFGHLSPAYRTPAIHNPERGI
TLADSRAICEYFEETVDKTPMINGTAANRAEIRRLVALFDESFFADVTSPLLEERMKKRL
VYRSPPDSKLLREAMRLADEHLYYIDYLIDNRPWLAGSTMSLADLAAAAQISVADYLGGI
DWSGHEQARGWYSVFKSRPSFRPLLGERMDVIQPPSHYADVNA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctctatcaattccccctgtgcccgttcagccgcaaggtgcgtctcctgctc
agcgagaagggcgtcgcctatgatctcgtgcgcgaaaacccgtgggagcggcgcgagggc
tttgggcacctcagccccgcttatcggacgccagcgatccacaatcccgagcggggcatc
accttggccgacagccgggcgatctgcgaatacttcgaggagacggtcgacaagacgccg
atgatcaacggcacggcagccaaccgcgccgaaatccgccgtctcgtcgccctgttcgac
gaaagcttcttcgccgacgtcaccagcccgcttctggaagagcgcatgaagaagcgtctc
gtctatcgttcgccgcctgacagcaagctcctgcgcgaggcgatgcggctggccgacgag
catctctactacatcgactacctgatcgataaccgcccctggctcgcgggctcgaccatg
agcctggcagacctcgccgccgccgcccagatctcggtcgcggactacctgggcggcatc
gactggtcgggccatgaacaggcgcgcggatggtattccgtcttcaagagccgccccagc
ttccgccctcttctgggcgagcgcatggacgtgatccagccgccctcccactatgccgac
gtgaacgcctga

DBGET integrated database retrieval system