KEGG   Novosphingobium aromaticivorans: Saro_3291Help
Entry
Saro_3291         CDS       T00322                                 

Definition
(GenBank) allosteric NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00620  Pyruvate metabolism
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
Module
nar_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_3291
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Saro_3291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ABD27726
UniProt: Q2G347
LinkDB All DBs
Position
complement(3508428..3510692)
Genome map
AA seq 754 aa AA seqDB search
MSEESNVRFTEREALFYHNTIRPGKIEIIASKPMATQRDLSLAYSPGVAVPVRAIAEDPS
TAYDYTAKGNLVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADVDSMDIELATED
ADAFIEAVALLEPTFGGINLEDIKAPECFIIEQALKERLKIPVMHDDQHGTAIISAAGLL
NACHLTGRRLEDVKVVVNGAGAAAIACTALIKAMGVRHDNVIMCDRSGVIYRGRESGMDQ
WKSAHAVDTTARSLEDALVGADIFLGLSAAGALKPEWVLKMAPQPIIFAMANPDPEITPP
DAKAVRPDCIVATGRSDYPNQVNNVLGFPFIFRGALDVRATAINEEMKIAAAEAIAQLAR
EPVPEEVAAAYGMNHTFGLDYIIPAPFDPRLMEVVSSAVAKAAMDSGVAQKPIEDFDAYR
TSLKARLNPTTSVLTNVFATAKDNPKRVVFAEAENEVVLRAAIQFKDFGYGTPVLVGRTQ
PVLDLLTELGVSDPSSYEIHNSAVSPLVPEMVEYLYERLKRRGYLERDVRRMVNQDRNVF
ASLLVALGHGDALITGMTRTFAQSMKEVRRVLDPKPGHLPFGIHLMVAKNYTVFLADTTV
NERPSAEDLAHIARETAAVARRMGHEPRVAFLSYSTFGNPYGRWLDSIRGAVAILDAENP
GFEYEGEMAPDAALNPKVMANYPFSRLSGPANVLIMPGLQSANISAKLLRELAGNAVIGP
MLLGMEKPVQIAPMTSIAPDILTLAVLAAAGIVG
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaaagcaacgtccgcttcaccgagcgcgaggcgcttttctaccataacacg
atccgcccgggtaagatcgagatcatcgcctcgaagccgatggcgacgcagcgcgatctc
agcctggcctattcgcctggcgttgcggtgccggtacgcgcgatcgcggaagatccgtcc
acggcgtacgactataccgcgaagggcaatcttgtcgcggtcatctccaatggcaccgca
atcctcggcctcggcaatctgggcgcgcttgcttccaagccggtgatggaaggcaaggcg
gtgctgttcaagcgctttgccgacgtcgattcgatggacatcgaactggcgaccgaagat
gccgatgccttcatcgaggcggtcgccctgctcgaaccgacgttcggcggcatcaacctt
gaagacatcaaggcgcctgagtgcttcatcatcgaacaggcgctgaaggagcgcctcaag
atcccggtcatgcacgacgaccagcacggcaccgcgatcatctccgctgctggcctgctt
aacgcctgccacctgaccggtcgccggctcgaggacgtgaaggtcgtcgtgaacggtgcg
ggggcggcggcaatcgcctgcaccgcgctgatcaaggcgatgggcgtgcgccacgacaac
gtgatcatgtgcgaccggtccggcgtgatctaccgtggccgcgaatccggcatggaccag
tggaagagcgcgcatgcggtcgacaccacggcgcgcagcctcgaggatgcgctcgtcggg
gcggacatcttcctgggtctttccgccgcgggcgcgctcaagcccgaatgggtgctgaag
atggcgccgcagccgatcatcttcgcgatggccaatccggacccggaaatcacgccgccc
gatgccaaggccgtccgcccggattgcatcgtcgcgacgggccggtccgactatcccaac
caggtcaacaacgtccttggtttccccttcatcttccgcggcgcgctcgatgtgcgggcg
accgcgatcaacgaagagatgaagatcgccgcggcagaggccatcgcccagctcgcgcgc
gagccggtgcccgaggaagtggctgccgcctatggcatgaaccacaccttcgggctggac
tacatcattcccgcgccgttcgatccgcgcctgatggaagtcgtctcctccgccgtcgcc
aaggcggcgatggattcgggcgtcgcgcagaagcctatcgaggacttcgacgcctatcgc
accagcctcaaggcgcgtctcaacccgacgacttcggtcctgaccaacgtcttcgccacg
gccaaggacaaccccaagcgcgtcgtcttcgctgaagccgagaacgaggtggtgctgcgc
gccgcgatccagttcaaggatttcggttatggcacgccggtgctggtgggccgcacccag
ccggttctcgacctgctgaccgaacttggcgtcagcgacccgtcgtcctacgagatccac
aactcggcggtttcgccgctggtgccggagatggtcgagtacctctacgaacggctcaag
cgtcgcggctatctcgagcgtgacgtcagacgcatggtcaaccaggaccgcaacgtcttc
gcctcgctgctcgtcgcgcttggacatggcgatgcgctcatcaccggcatgacgcgcacc
ttcgcgcagtcgatgaaggaggtacgccgcgtcctcgatccgaagccggggcacctgccc
ttcggcatccacctgatggtggcgaagaactacaccgtgttcctcgccgacacgacggtg
aacgagcgtccctcggccgaagacctcgcgcacatcgcgcgcgagaccgccgccgttgcc
cgccgcatgggccacgagccgcgcgtggcgttcctgtcctattcgaccttcggcaatccc
tatggccgctggctcgattcgatccggggcgcggtggcgatcctcgacgccgagaatccc
ggcttcgagtatgagggcgaaatggcgccggacgccgcgctcaaccccaaggtcatggcg
aactatccgttcagccgcctctcgggcccggccaacgtgctgatcatgcctgggctgcaa
tcggccaacatctcggccaagctgctgcgcgaattggcgggcaatgcggtgatcgggccg
atgctgctgggcatggagaagccggtgcagatcgcgccgatgacgtcgatcgcgcccgac
atcctgaccctggccgtgctggcagcggcgggcatcgtcggctga

DBGET integrated database retrieval system