KEGG   Natrinema sp. J7-2: NJ7G_0114Help
Entry
NJ7G_0114         CDS       T02184                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00071  Fatty acid degradation
nat00280  Valine, leucine and isoleucine degradation
nat00281  Geraniol degradation
nat00362  Benzoate degradation
nat00592  alpha-Linolenic acid metabolism
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01130  Biosynthesis of antibiotics
nat01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NJ7G_0114
   00592 alpha-Linolenic acid metabolism
    NJ7G_0114
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NJ7G_0114
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    NJ7G_0114
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NJ7G_0114
   00642 Ethylbenzene degradation
    NJ7G_0114
Enzymes [BR:nat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     NJ7G_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFO55368
UniProt: I7CN38
LinkDB All DBs
Position
complement(114298..115440)
Genome map
AA seq 380 aa AA seqDB search
MSDRQPVVVQAVRTPQGKHGGVFAETGSEELSVPLVDELLERTGLSGEDVDDIRWGCAKQ
VNEQSNNIARVIALLSDLGEGVPGTTIDRLCASSAEAIMSASDAIRAGQRDVIVAGGVEN
MSRNERRKGIDSYDGIAEQYDAAGLAMGQTAETVAEEFDISRDQQDAYGARSQQRACEAT
AAGAFDAEIVPIETADALVEEDEGLRPGTTKETIADLPPAFREEGTVTAANASQVSDGAA
GVLITSREFAEREGLEIMAEIEDHNVAGVDPTIMGIGPVPAVRGIWERNGRSADDYDLVE
LNEAFASQTIYCRDELGFDDDRVNVNGGAIAIGHPLGASGARLPVTLIHELQRRGGGLGL
STMCVGYGQGAAIEFRVPEP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgccagccagtcgtcgtccaggcagtcagaacgccgcaagggaaacacggt
ggcgtcttcgccgaaaccggcagcgaggagctgtcggtcccgctcgtcgacgagctgctc
gagcgcacgggcctctcgggcgaggacgtcgacgacatccggtgggggtgtgccaagcag
gtcaacgagcaaagcaacaacatcgcgcgggtgatcgccctcctgtcggacttgggcgag
ggcgtccccggtactacgatcgaccggctctgtgcctcctcggcggaggcgatcatgagc
gccagcgacgcgatccgggcgggccagcgcgatgtcatcgtcgccggcggcgtcgagaac
atgtcccgcaacgagcgccggaaggggatcgactcctacgacggcatcgccgagcagtac
gacgcggccgggctcgcgatgggccagaccgccgaaaccgtcgccgaggagttcgacatc
agtcgggaccagcaggacgcgtacggcgcgcgcagccagcaacgggcctgcgaggccacc
gcggcgggcgcgttcgacgcggagatcgtccccatcgagacggcggacgcgctcgtcgag
gaggacgaaggcctccgccccggaacgaccaaagagacgatcgccgacctcccgccggcg
ttccgtgaggagggcaccgtcaccgccgccaacgcttcgcaggtctccgacggcgctgcc
ggcgtcctcattacaagccgcgagttcgccgaacgggagggcctcgagatcatggccgag
atcgaggaccacaacgtcgccggcgtcgacccgacgatcatggggatcggtccggtcccc
gcagtccggggcatctgggagcgaaacggccggtcggccgacgactacgatctcgtggaa
ctcaacgaggccttcgccagccagacgatctactgccgggacgaactcggcttcgatgac
gaccgggtcaacgtcaacggcggcgcgatcgccatcggccacccgctcggtgcgtcgggc
gctcgcctccctgtcacactgatccacgaactgcagcgtcggggcggcggcctcggcctc
tcgacgatgtgcgtcggctacgggcagggtgcggcgatcgagttccgtgttcccgagccg
tag

DBGET integrated database retrieval system