KEGG   Natrinema sp. J7-2: NJ7G_0263Help
Entry
NJ7G_0263         CDS       T02184                                 

Gene name
argX
Definition
(GenBank) putative glutamate-argW ligase
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00300  Lysine biosynthesis
nat01100  Metabolic pathways
nat01210  2-Oxocarboxylic acid metabolism
nat01230  Biosynthesis of amino acids
Module
nat_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NJ7G_0263 (argX)
Enzymes [BR:nat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     NJ7G_0263 (argX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP CPSase_L_D2 ATP-grasp_5 ATP-grasp ATPgrasp_ST ATP-grasp_2 ATP-grasp_4 DUF2268
Motif
Other DBs
NCBI-ProteinID: AFO55518
UniProt: I7CNN7
LinkDB All DBs
Position
complement(255213..256094)
Genome map
AA seq 293 aa AA seqDB search
MTLHVGLLYSRIRKDEKLLLTELRERDHEVTKIDVRKQTFDISAAPAAFDGLDIVVDRCL
ATSRSLYATQFFEAYGIPVVNSHETADICADKVQNSLALEKAGVPTPATKVAFTKETAME
AIEEFGYPCVLKPVVGSWGRLMAKIDSESAAEAILEHKATLGHYEHKVFYVQEFVEKPGR
DIRVLATDGEPIAAMVRSSDHWITNAAKGAETDVFELDDEALALVRKASDAVGGGLLGID
LMEIGDSYTVHEVNHTVEFKALDDAVETDIAATVVDWLEGKADAAADELEVTA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttgcacgtaggactcctctactcacggatccgcaaggacgagaagctcctcctc
accgagcttcgcgagcgtgaccacgaggtcacgaagatcgacgtccgcaaacagaccttc
gacatctcggcggctcccgcggcgttcgacggcctcgatatcgtcgtcgatcgctgtctc
gccacgagccggagcctgtacgccacgcagttcttcgaggcctacggcatccccgtggtc
aacagccacgagaccgccgatatctgcgctgacaaggtgcaaaacagcctcgccctcgag
aaggcgggcgtgcccacccccgcaacgaaggtcgcgttcaccaaagagaccgcgatggag
gccatcgaggagttcggctatccgtgcgtgctcaaacccgtcgttgggtcctggggccgg
ctgatggccaagatcgactccgagtcggccgcggaggccattctcgagcacaaggcgacg
cttggccactacgagcacaaggtgttctacgtccaggagttcgtggagaagcccgggcgt
gacatccgcgtgctcgcgaccgacggcgaacccatcgccgcgatggtccgctcgtcggac
cactggatcaccaacgccgcgaagggtgcggagacggatgtcttcgaactcgatgacgag
gcgctggcactcgttcggaaggccagcgacgccgtcggcggcggcctgttgggcatcgac
ctgatggaaatcggcgattcgtatacggtccacgaggtcaatcacaccgtcgagttcaag
gccctcgacgacgccgtcgagacggacatcgcggccaccgtcgtcgactggctcgagggg
aaagccgacgcggccgccgacgaactcgaggtgaccgcctga

DBGET integrated database retrieval system