KEGG   Natrinema sp. J7-2: NJ7G_1274Help
Entry
NJ7G_1274         CDS       T02184                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00620  Pyruvate metabolism
nat00680  Methane metabolism
nat00720  Carbon fixation pathways in prokaryotes
nat01100  Metabolic pathways
nat01120  Microbial metabolism in diverse environments
nat01200  Carbon metabolism
Module
nat_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NJ7G_1274
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NJ7G_1274
   00680 Methane metabolism
    NJ7G_1274
Enzymes [BR:nat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NJ7G_1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Activator-TraM Peptidase_M16
Motif
Other DBs
NCBI-ProteinID: AFO56523
UniProt: I7CR76
LinkDB All DBs
Position
complement(1138061..1140751)
Genome map
AA seq 896 aa AA seqDB search
MRLHNRDVRQDVRELGALLGTVLEEQTSRRSFETVESSRQAAIEYRSGDRESRDSLVTEL
EGLSPHQQRIVARAFTTYFELINLAEERERVRTIRTESHEGTLDDSLETAAAELSDADIE
TVQQVLDDVLIEPTFTAHPTEARRKTVKSKLRDISTSLETLDERLLTDKEERQLWRDIDA
EVTSLWQTPQVRNRQPEPEDEARNVQWYLENTLFEVVGEVYDELDDAIDAEIPGDIDIPK
LFEFRSWAGSDRDGNPYVTPDVTATTLERQRSVILEQYRTQLKRLSGVLSQDGSRIDAGS
EFQASLERDRDRLPGSARTAEERYPGEPYRQKLKLMRERLRRVGDVRPGGYDDVDALLAD
LEVIATSLRNNGAESVVDAHVDPIRRQVATFGFSLASLDLREHQAKHTDAIADALEAEGI
DYHGLSEGERVEFLTDAVLQDEPVIDLGDTDELSADSARVLRLFDSLADWQTEYGVNAID
TYCISMTEEPSHVLEVLFLADQAGVVSLPEHAGIDIVPLLETEYALSGARRIMGSLFENE
AYAQVLEARGRTQEIMLGYSDSNKENGFLAANWSLYKNQRRLGEICDDHDVTMRLFHGRG
GSISRGGGPMNEALLALPNSTVTGQVKFTEQGEAIAEKYANPRIAERNIEQMLNAQLRAR
KQAIDQPEEEVHEEWIDAMETMADAARREYRDLLESDGFVQYFEQATPITVIEDLDLGSR
PASRSGERTVEDLRAIPWVFSWTQSRCILPGWYAIATGVEAYLEDGGSMETLQEMYDEWP
FFQTTLDNAALSLSRTELEIAERYAEMAADDLRDRFFPRVAGEYERTTDLITEIGQRETL
HTRDWLGENLERRNPYVDPLNMLQVYLLNRTHRTDIEERTLRLTVKGIAAGMKNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgcgactccacaacagggacgtccgacaagacgttcgcgaactcggtgcgttgctcggg
accgtcctcgaggagcagacgtcccgcaggtcgttcgagaccgtcgaatccagtcgacag
gccgcgatcgagtaccgatcgggggaccgcgagtcgcgagactccctcgtcacggaactg
gaggggctctcgccgcatcaacagcggatcgtcgctcgcgcgttcacgacctatttcgaa
ctgatcaacctcgccgaggagcgcgaacgggttcgcacgatccgcactgagtcccacgaa
ggaaccctcgacgacagcctcgagaccgcggccgcggaactcagcgatgccgacatcgaa
accgtccagcaagtgctggacgacgtcctgatcgaaccgacgttcactgcccacccgacc
gaggctcgtcgcaagaccgtcaaatccaaactcagggacatttcgacctctctcgaaacc
ttagacgagcggctgctgaccgacaaggaggagcgccaactctggcgggacatcgacgcg
gaggtcacgagcctctggcagaccccgcaggtccgcaatcgtcagcccgaacccgaagac
gaggcgcgcaacgtccagtggtacctcgagaacacgctgttcgaggtcgtcggcgaggtc
tacgacgaactcgacgatgcgatcgacgcggagatccccggcgacatcgacattccgaag
ctcttcgagttccgctcgtgggcgggcagcgaccgcgacggcaacccctacgtgaccccc
gacgtgaccgccaccaccctcgagcgccagcgctcggtcatcttagagcagtaccgaacc
caactcaagcgcctctccggggtgctgagtcaggacgggagtcggatcgacgccggctcc
gagttccaggcctccctcgagcgcgatcgggaccggctccccgggagcgctcgcacggcc
gaagagcgctaccccggcgagccctaccgacagaagctcaaactcatgcgggagcgactc
cgccgcgtgggcgacgtgcgcccgggcggttacgacgatgtcgacgccctcctcgcggat
ctcgaggtcatcgcgacgagcctgcgcaacaacggggccgagagcgtcgtcgacgcccac
gtcgatcccatccgccggcaggtcgccacgttcggcttctcgcttgccagtctcgatctg
cgcgagcatcaggcgaaacacaccgacgccatcgcggacgccctcgaggccgaagggatc
gactaccacggcctttcggagggcgagcgcgtcgagttcctgaccgacgccgtgttacag
gacgagccggtgatcgatctgggtgacactgacgaactctcggccgactcggcgcgggtc
ctccggctgttcgacagcctcgcggactggcagaccgagtacggcgtcaacgccatcgac
acctactgcatctcgatgaccgaggaaccgagccacgtcctcgaagtactgttcctggcc
gatcaggccggcgtcgtctcccttcccgagcacgccggaatcgacatcgtcccgctcttg
gaaaccgagtacgccctctcgggggcgcggcgaatcatggggtcgctgttcgagaacgag
gcctacgcgcaggtgctcgaggcccgcggccggacccaggagatcatgctcggctactcg
gactcgaacaaggaaaacggcttcctcgcagccaactggtcgttatacaaaaaccagcgc
cgattgggcgagatctgcgacgaccacgacgtgacgatgcggctgttccacggccggggc
ggctcgatctcgcgaggtggcggcccgatgaacgaggcgctgctcgccttgccgaactcg
acggtcacggggcaggtcaagttcaccgaacagggcgaagcgatcgccgagaagtacgcc
aacccccgtatcgccgagcgtaacatcgaacagatgctcaacgcgcagctccgggcacgc
aaacaggcgatcgaccagcccgaggaagaagtccacgaggagtggatcgacgccatggag
accatggccgacgccgcccgccgggagtatcgcgacctcctcgagagcgacgggttcgtc
cagtacttcgaacaggcgaccccaattacggtcatcgaagacctcgacctggggtcgcgg
ccggcctccaggtcgggcgagcgcaccgtcgaggacctgcgggcgatcccgtgggtgttc
tcctggacccaatcgcggtgtatcctgcccggctggtacgcgatcgcgaccggcgtcgaa
gcctacctcgaggacggtggctcgatggaaaccctacaggagatgtacgacgagtggccg
ttcttccagacgacgctggacaacgccgctctctcgctgtcgcgaaccgaactcgagatc
gccgagcggtacgccgagatggcggccgacgaccttcgcgatcggttcttcccccgcgtt
gccggcgagtacgagcgaacgaccgatctgatcaccgagatcggccagcgcgagacactc
catacccgcgactggctcggcgaaaacctggagcggcggaacccctacgtcgacccactg
aacatgctgcaggtctacttgctcaaccgtacccatcggacggacatcgaagagcggacc
ctgcggctgacggtcaagggaatcgcagccggcatgaagaacacgggctaa

DBGET integrated database retrieval system