KEGG   Natrinema sp. J7-2: NJ7G_1450Help
Entry
NJ7G_1450         CDS       T02184                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00564  Glycerophospholipid metabolism
nat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NJ7G_1450
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NJ7G_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox NAD_binding_8 FAD_oxidored Lycopene_cycl HI0933_like ApbA GIDA 3HCDH_N Pyr_redox_3 NAD_binding_7 TrkA_N NAD_binding_9 Thi4
Motif
Other DBs
NCBI-ProteinID: AFO56697
UniProt: I7BK14
LinkDB All DBs
Position
complement(1295716..1296948)
Genome map
AA seq 410 aa AA seqDB search
MDSRTDALVIGGGATGTGLARDLARRGVDVTLVERDGLSSGTSGRSHGLLHSGARYAEAD
GPEARACLEENRILRRIGGACVRETRGLFVQLADDEPAYFEAKRDACADVGIETEVVGGD
AAREAVPDLAADVERAMWVPDGVVLPSRLSAANAVDAREHGARIRTHAPVTDVTVEDGRV
TSVVLGGDADETVRPTYVVNATGPHAGRIADMMGATVEMRPTRGVMVSVEYDGLEPVLNR
CREPDDGDIIVPHDGEVVLGTTSVSVADPDDYEQAEWEIAETVRECAAMLPPVATAPRVR
TWWGVRPLYEPEEAARGGRGISRGFHLLDHADEGVANCCSIVGGKLTTYRRMAEATADHV
CDRLGVTADCSTADERLPGASEPARLDAFVREFDGQGPTDADLVGTGSSY
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgaacggacgccctcgtgatcgggggcggtgccaccgggacgggactcgcc
agggacctcgcgcggcgcggtgtcgatgtgacgctggtcgagcgggacgggctctcgtcg
gggacgtcgggccggtcacacggcctgcttcacagcggggctcgctacgctgaggccgac
ggcccggaagccagggcgtgtctcgaggagaaccgcatcctacgccgcatcggcggcgcg
tgcgttcgagagacccgcgggctgttcgtccaactcgcggacgacgagccggcgtacttc
gaggcgaagcgcgacgcctgtgcggacgtgggaatcgagaccgaggtcgtcggcggggac
gcggcccgcgaggcggttccggacctcgccgccgatgttgagcgagcgatgtgggttccc
gacggcgtcgttctcccctcgcggctgagcgccgccaacgcggtcgatgcccgcgagcac
ggtgcacgaatccgtacgcacgcgccggtcacggacgtgactgtcgaggacggacgggtg
acgagcgtcgtcctcggcggcgacgccgacgaaacggtgcggccgacctacgtcgtgaac
gcgaccggccctcatgccggccggatcgcggacatgatgggggcgaccgtcgagatgcgt
ccgacacgcggcgtcatggtttcggtcgaatacgacggcctcgagccggtcctcaatcgg
tgtcgcgagcctgacgacggcgacatcatcgtgccccacgacggcgaggtcgtcctcggc
acgacgagcgtgtcggtcgccgatcccgacgactacgagcaagccgagtgggagatcgcg
gagacggttcgggagtgcgcggcgatgctgccgccggtcgcgaccgcgccccgcgttcgg
acgtggtggggcgtccgaccgctgtacgaacccgaggaggccgctcgcggcggccgcggg
atttcgcggggctttcacctgcttgatcacgccgacgagggcgtcgcgaactgttgtagc
atcgtcggcggaaaactgacgacataccgccgaatggccgaggcgaccgcggatcacgtc
tgcgaccggctcggggtaaccgccgactgttccaccgcggacgagcgactgccgggggcg
tcggagccggcccgactcgacgcgttcgttcgggagttcgacggacagggaccgacggac
gccgatctcgtcgggaccgggagtagctactga

DBGET integrated database retrieval system