KEGG   Natrinema sp. J7-2: NJ7G_2809Help
Entry
NJ7G_2809         CDS       T02184                                 

Definition
(GenBank) peptidase M20
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00220  Arginine biosynthesis
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01130  Biosynthesis of antibiotics
nat01210  2-Oxocarboxylic acid metabolism
nat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NJ7G_2809
Enzymes [BR:nat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     NJ7G_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFO58037
UniProt: I7BNC0
LinkDB All DBs
Position
complement(2428850..2429953)
Genome map
AA seq 367 aa AA seqDB search
MTLVELTRELVSIPSHEDAAAAGDVLESWLRRETDADVTRDAVGNVIARKGTGPETLALV
GHHDVVAPAESQVAIADGNVDEASEYVVEERDGRLYGRGAADMKGALAAALLAFRDADPA
GELVVASFVGEEIGGVGARYAIDDGFAPEYAIVGEGSTNYSSPNVTDVAVAHKGRRGSTI
TARGTAAHASEADAGENAIYRATAAVDRVRGLEAPSVDVAGDSIAGRLTVTEIEGGSAMN
VVPARCVVTVDERTVPGERAALERVADLDGVEWTVDQDLPPMHCDDETFAETVLGAADGV
QAAEPELVTKPHATDAGWLSQAGTDCVIYGPSEPGEAHTDDESVSIAVLERCHETYRRVA
ERWPSAR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgtcgagttgacccgcgagctcgtgtcgatcccgagccacgaagacgcggcc
gccgccggtgatgtcctcgagtcgtggctgcgccgcgagaccgacgccgacgtgactcgg
gacgccgtcgggaacgtgatcgcccgaaaagggacgggacccgagacgcttgcactggtc
ggacatcacgatgtcgtcgcgccggccgagtcgcaggtcgcgatcgcggacgggaacgtc
gacgaagcgagcgagtacgtcgtcgaggagcgagacggccgcctgtacggccgcggggcg
gcggacatgaaaggagcgctcgcggccgcgctgctggccttccgcgatgccgaccccgcc
ggcgaactcgtcgtcgcgagcttcgtcggcgaggagatcggcggcgtcggcgcacgatac
gcgatcgacgacgggtttgctcccgagtacgccatcgtcggcgaggggtcgacgaactac
tcgagcccaaacgtcaccgacgtggccgtcgcccacaagggccgtcgcgggagtacgatc
accgctcgcggcaccgccgcacacgccagcgaagccgacgccggcgagaacgccatctat
cgcgccaccgcggccgtcgatcgcgttcgcggactcgaggccccgtcggtcgacgtggcg
ggcgactcgatcgcaggccggctcaccgtcacggagatcgagggcgggtcggcgatgaac
gtcgtccccgcccgctgtgtggtcacagtcgacgagcggacggtgccgggcgaacgtgcg
gccctcgagcgggtcgccgacctcgacggcgtcgagtggacggtcgaccaggacctgccg
ccgatgcactgtgacgacgagacgttcgccgagacggttctcggggccgctgacggcgtg
caagcggccgagcccgaactggtaacgaaaccccatgcgacggatgcgggatggctctcg
caggccgggaccgactgcgtgatctacggcccgtccgagcccggcgaggcccacaccgac
gacgagagcgtctcgatcgccgttctcgagcgctgtcacgagacctatcggcgggtcgcc
gaacggtggccgtcggcgcggtga

DBGET integrated database retrieval system