KEGG   Nicotiana attenuata: 109206336Help
Entry
109206336         CDS       T05870                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
nau  Nicotiana attenuata
Pathway
nau03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109206336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nau01001]
    109206336
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nau03032]
    109206336
   03400 DNA repair and recombination proteins [BR:nau03400]
    109206336
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109206336
Protein kinases [BR:nau01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109206336
DNA replication proteins [BR:nau03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109206336
DNA repair and recombination proteins [BR:nau03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    109206336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC TAN
Motif
Other DBs
NCBI-GeneID: 109206336
NCBI-ProteinID: XP_019224705
LinkDB All DBs
Position
2
AA seq 3009 aa AA seqDB search
MVNTVTSRDIQDIVSKLSSDKAKSREEGIKLLNAWLEEGQRSVEFCRYVGEKTARLKPDE
IPHSETWPFLVTLLTKCVSLEISGSKKRLPKLNFAKTLRIVVQRAEDAKFSGKDMLLLPV
AKLLFNHVWDVLKDTPSFQSEYGTILRHLLAVRSYRFHMRKRVYCCLVLLYMEKIETSLK
EKSDSQINPREEVFRCISTLHSLLENPPGGFPDSLQEDIVKGFVVIFSYVRDEGKISRKL
IECINIYLLKDGPNLGSKSLEIHDALHHFVFRCWMTTRDRGLKDSLVLYARLQLNLTRDF
ADGSSLLEQLQDVLGKELDQMSSWTINLPWKDTTRDDKCGSLTSSQCGLMELAALVFYRA
CLNTPIASSSEKRLRREHVVVQIRERLSRGKWPWHAAFCYLIHNYYGRIKKDLLIYWFEG
ICASFERIINDANMEHSYEGLLWTLRSLQGLSLMLRFPVPALQTSSELSSTFNGVETGWR
TIWNCVIGGLPTFSTFTAVVDAALRLLRNIILNDKINAYLVPQDLWDLRLLKRVPSISVL
CFILCYFSRKGYQGDLRDALYLRQNLLRAVLAVPFWKDCSMLNKQLVAILPTAVYVLCTG
GTPLLDKGLSQSHYVPETLNDVKVEDHTHESEHEFFECSVEVLARIGHESDLEDVQSPGC
QSIRLPRQIRDPLCHEVENHILEIIKDEEHEKMLLSDVIFLCAILSNFMYCSYSTRLGEE
IVPCLATLSQYVSKLLDRAASILEKSYDDLVCGLSGSRSIFDTIGTIRVSFESFLCSPLF
NEMQNDNSIDVLAAVIQSVERILKVLAKLYEGSSSSGSNFHSKRDDLDSSASVSSHDSHP
VNSRTSMIMDMELDVNISSKDTDAVKIGGKPTAEILASSVNQRMEVVSIITKFFSALPFH
TWDVMFELMEKESDPRVLEVIIHRLCQHPHWSSSGKFLNLVTSLNDFLDIQANLKVQSLN
VLTAICSLLESLLSCDDVAKFKKSREKLPEEGLISLGDLVNKIADSDLFDWVGRTKLIDC
ICNFILVDPQIGQSMIEKLLVMLRDPDYRVRLCFAQRVGVLFQTWDGHFELFQDICSNFG
TKLVTCSREKLVMAKEVLAAGPQPRTILETIIVTLAHLALHSEKIELEAVFMVCVIAAIN
PCLRKLVIVVLDNLSRELKYTSRSKYMEELMAPILFNWVASGVNLAALLEARDLFVFNVE
PMNFIQSCCRWLLPSLILHGDISNMNWLAKVACEPLAEMIKNHFVDIFSVCITLHSSKKA
GWEKGSAVLESSILDIAKISETERDKLIKKHMVSIVNTIFSLASTAVDPVLPLFSKETIA
RAIMTVVDGFLEIDDSCQNFGLIDKINIFRPDRVFTFIVEMHYKVAAAGHFRHKSDRLAG
IEVLIDVLGHRVAVPSTASYLLNLIGQCLDLDALLDQCCRMISSLLKFFKIKQLEGTTVV
LGEQLQFLISKLVMCCISSESSPKLSADTSSQVLSLLSQLTLDSDPSLHEYIKELEPFPN
LDLFHDIRMFHEELSQNYSPREHLSILGKRSRYLPPRLLVWSLKALHKKLFEDEAYPAQK
NEENIFEDAYLDSDHDIVHTVWNLVHTCSLSGAGNFGSLVSDFLSRVGIGDPHGVVFHLP
IESKSVHEHNFHLDTGISDDLLVAIMRLLKKYLMDDSVKIIDIASQALRGILSTENGQRA
LLSFDSYQRSLIEVHSKGVNVNLVQKLLADLERKLNVEALSLKDSAIWKTDGKTFETWIC
PLVCALIEYCDDMILRLCQDIVLVKSEVAELLFPHVMVNLSSRRDVDVDLCQLISSQVQE
NIFTEDNKLTKSIQVILDALNELRLCHVMERSTSSNPSKRENSKQYGRPSSYGSKSRSMP
LKAKHQTTTSSVVSISTLSWEKVYWISMDYLAVARSAITSGAYFTAVLYVEHWCEENFNS
LTLGTPDFSHVEILPRHIEILLSAVTQINEPDSLYGIIQSHKLTSQIITFEHEGNWSKAL
EYYDLQIRSDPVAQGSSCTPENFLHSSGSAVDQMIEKKPYKGLIRSLQQIGCTHLLDVYC
QGLTSQKGRFQHDSEFTELQYEAAWRSGNWDFSLLYGESSVLSIQHGGDHFNENLHSCLR
ALKEGGFDEFQIKLKDSKQELLLSICHASAESTKYIYQAIVKLQILYHLGMTWDSRWTSS
CTMLDSLKMPKVSSKPVLPSITQLSWLDMDWKRTLKQAQLHMNLLEPFVAFRRVLLHILN
CQDYTVQHLLESAATLRKVARFSQAASALHEFKFLCAEMGEHSNLYWLGRLEEAKLLRAQ
GQHQMAINLAKYISLNHQTNENASDVFRLIGKWLAETRSSNSRTILEKYLKHAVLLAEDC
MAQGKVSAIKRSQLHFHLAHYADALFRSYEERLNSSEWQAAMRLRKHKTRELEALVKRLR
SSTKGEKTDLSAKIQELQKQLAMDKEEAEKLQEDRDNFLSTALDEYKRCLVIGDKYDVRV
VFRLISLWFGLSFRPIVVDSMLGTISEVQSYKFIPLVYQIASRMGSTKESQGAQNFQFAL
VSLIKRMAIDHPYHTIFQLLALANGDRIKDKQRSRSSFVVDMDKKVAAENLLKELSSYHG
AVIRQMKQMVEIYIKLAELETKREDTNKKVNLPREIRSIRDLELVPVVTANIAIDPSCQY
TEGSFPHFKGLADSVTVMNGINAPKVVECFGSDGNKYRQLAKSGNDDLRQDAVMEQFFGL
VNTFLQNHRDTWKRRLRIRTYKVVPFTPSAGVLEWVNGTLPLGEYLIGSTRDAGAHGRYG
AGDWTFMKCRQHMTVESNKRKAFQEVCDNFRPVMHHFFLERFFHPADWFQKRLAYTRSVA
ASSMVGYIVGLGDRHSMNILVDQATAEVVHIDLGVAFEQGLMLKTPERVPFRLSRDIIDG
MGVTGVEGVFRRCCEETLSVMRTNKEALLTIIEVFIHDPLYKWALSPLKALQRQKESEDD
LETSLEDSQRDDYEGNKDAARALMRVKQKLDGYEEGEMRSVHGQVQQLIHDAIDPDRLCH
LFPGWGAWL
NT seq 9030 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatactgtgacgtccagagatattcaggacattgtctccaaactctcatcagat
aaagcaaaatctcgtgaagaagggattaagttgttaaatgcatggctagaagaaggccaa
aggtctgttgagttctgcagatacgttggagagaagaccgcgaggcttaaaccagacgaa
attcctcattctgagacgtggccctttcttgttacattgcttactaaatgtgtgtccctg
gagatatctgggagcaaaaaacgtttgcccaagttgaattttgctaaaactcttcggatt
gttgtccaacgagcagaggatgccaaattttcaggcaaagatatgcttcttttacctgtg
gcaaaattgcttttcaatcatgtctgggatgtcttaaaggatactcctagttttcaatcc
gagtatggaactattctccggcatcttttggcagtgagatcttaccgttttcacatgagg
aagcgggtttactgttgtttggttcttctatacatggaaaagatagaaacaagtttaaaa
gaaaaaagtgatagccaaataaatccaagagaggaggtctttcgctgcatctcgacactt
cattctctccttgaaaacccccctggaggttttcctgatagccttcaagaggatattgtc
aagggttttgttgtaattttttcttatgtaagggatgaagggaagatttcacgcaagcta
atcgagtgcattaacatatacttgctgaaggatggcccaaatttgggttctaaatccctg
gaaatccatgatgctctgcatcattttgtcttccgatgttggatgacaactcgtgatcgt
gggttaaaggattcgcttgttctttatgctaggctacagctaaatttgacgagagatttt
gctgatgggagctctttattagaacaacttcaggatgtattagggaaggaattagatcaa
atgagcagttggaccatcaatttaccctggaaagacacaaccagggatgacaaatgtgga
agcttgacaagctctcagtgtggtcttatggagcttgcagcacttgtcttttaccgggca
tgtcttaacacacctatagcatcgtcatctgagaaacgacttagaagggagcatgttgta
gtccagataagggagaggctctcaaggggaaagtggccgtggcatgcagctttctgttac
ctcatccacaattattatggtcgcataaagaaggatttgttgatctattggtttgaaggt
atatgtgcaagctttgaaaggataataaatgatgcaaacatggagcatagttatgaaggt
ctcttgtggacattgaggagtcttcaaggactttctttgatgctgcggtttcctgttcca
gcactgcaaacatcttcagagttgtcatccacatttaatggggttgaaacaggttggcgt
acgatatggaactgtgttattggtggtttgcccacattcagtacttttacagcagttgtg
gatgctgcattaaggctacttagaaacataatactcaatgataaaattaatgcatacctt
gtgccccaagacttgtgggatcttcgattacttaaacgcgtgccatcaatatctgttttg
tgcttcattttgtgttacttttcaaggaaaggctatcaaggtgatcttagagacgcttta
tatttgaggcaaaatcttttgagagctgttttggctgttcctttctggaaggactgttca
atgttgaataaacagctggttgctatattgcctacagctgtttatgttctctgtactggt
ggtacaccattgctagataaaggactttcccagtcacactatgttcctgaaactctgaat
gatgtgaaggtcgaagatcatacacatgaaagtgagcatgaattttttgaatgctccgtt
gaagttcttgcaagaattggacatgaatctgatctggaggacgttcagtcacctggttgc
caaagcatacgtcttccccggcagatcagagatccactttgtcacgaagtcgaaaatcac
attcttgaaattataaaagatgaagaacatgaaaagatgcttctatctgatgtcatcttc
ctctgtgctattttatcaaacttcatgtattgttcatatagtacaaggctaggagaagaa
attgtgccttgccttgccactctgagtcaatatgtgtcgaagttgttggatcgagctgct
tctatcttagagaaaagttatgacgacctcgtttgtggtttgtcgggttcaaggtcaata
tttgacacaattgggaccattcgtgtgtcctttgaaagctttctatgctccccattgttt
aatgagatgcaaaacgacaacagcatagacgtactagctgcagtaattcaatctgtggag
aggattctgaaggttcttgctaaactgtatgaaggatcctcaagtagtggaagtaatttt
cattcaaagagggacgaccttgactcttctgcatctgtttctagtcacgattctcatcca
gtaaatagccgtactagtatgatcatggacatggagttggatgtgaacattagttccaaa
gatactgatgctgtaaaaattgggggaaaacctactgccgaaatattggcttcgtctgta
aatcagagaatggaagtcgtatcaatcatcacaaagttcttttcagctttaccatttcat
acatgggatgtcatgtttgagctcatggagaaagaaagtgatccaagggtcctggaagta
atcatacaccgcctttgtcaacatcctcattggtcttccagcggaaagttcttaaatttg
gttacatccttaaatgatttcttagacattcaggcaaatctcaaggtccagtctctgaat
gtgctaactgccatctgcagtttgttggagagtcttctatcctgtgatgatgttgcaaag
ttcaaaaagagtcgggaaaaattacctgaagagggcttgatttctcttggagacctggtg
aacaaaattgcagacagcgacctctttgattgggttggccggaccaagcttattgattgc
atttgcaatttcattttagtggatcctcaaattggtcagtctatgattgaaaagctgctg
gtgatgcttcgggatcctgattatcgagttaggttatgctttgctcaacgagttggtgtg
cttttccaaacttgggatggtcattttgaactattccaggacatatgttcaaattttggc
acaaagcttgtgacttgctccagagagaaactggtgatggcgaaggaggttttagctgct
ggtcctcagcctcgtaccatattggaaacgataattgtaaccctagctcatcttgcgctg
cacagtgaaaaaattgaattggaggctgtttttatggtatgtgttattgctgctattaac
ccttgtctaaggaaacttgttattgttgtccttgataatctatcaagggagttaaagtat
acttctaggtcaaagtatatggaagaacttatggccccaatcctctttaattgggttgct
tctggtgtaaatttagctgctcttctcgaggcaagggatctgttcgtcttcaatgtagag
cctatgaatttcattcagtcctgctgccgttggcttcttccatctttaatcttgcatggt
gacatttctaacatgaattggcttgcgaaggttgcttgtgagcctcttgctgaaatgatt
aagaatcactttgtggatattttctctgtttgtattacgttacactccagtaagaaggct
ggttgggagaagggatcagctgtacttgaaagttcaattctggatattgctaaaatatct
gaaactgaaagagacaagcttataaagaagcacatggtttcaatcgtgaatactattttc
tctcttgcttcaacagctgtggaccctgttcttcctttattttccaaggagacaattgca
cgtgcaattatgacagttgtggatggattcttggagatagatgactcttgtcaaaatttt
ggccttattgacaagattaacattttccgacctgatcgagtatttacgtttatagtagag
atgcattacaaagttgctgcagctggtcatttcaggcataaatctgacaggcttgctggg
attgaagtgcttattgatgtattagggcatcgagttgcggttcctagtactgccagttat
ctcctcaacttgattggtcaatgcttggaccttgatgctttgctggaccaatgttgtcga
atgatctcttcattgctaaagtttttcaaaataaagcaattggagggaaccactgttgtc
ctaggtgaacagcttcagtttttaatttccaagttggtaatgtgttgcatttcttccgag
tctagtcccaaactgtcagctgacacatcatctcaagttttgtctctgctcagccaactt
accttggactctgacccatctctacacgagtacattaaagaactagagccattccctaac
ctcgatttatttcatgatatacggatgttccacgaggaactaagtcaaaattactcgcct
agggagcacttgtcaatcttagggaaacgatctcgctaccttccgccaaggttacttgtc
tggagtctaaaagcattacacaaaaaattgtttgaagatgaagcatacccagcacaaaag
aatgaggaaaatattttcgaagatgcatatttggattctgaccatgacattgtccacaca
gtctggaacctggtgcacacatgtagtttgagtggtgctggcaattttgggtcgctggtc
tctgattttttatctcgggttggtatcggcgatccgcatggtgttgtgttccatcttcct
atcgagtctaaatctgtacatgagcataacttccaccttgatacgggcatatcagatgac
cttctggtggcaattatgaggcttttaaagaaatatttgatggatgactctgttaagata
attgacatagcatctcaagctttgcgggggatactttcaactgaaaatggtcagagggct
ttgctatcatttgattcttatcagagatcccttattgaggtgcattccaaaggtgtcaat
gtcaacctggttcagaaactcctggcagatctagaaagaaagcttaacgttgaggctctt
tccttgaaggattctgctatatggaagactgatggaaaaacattcgagacatggatttgt
cctcttgtctgtgctctgattgaatattgtgatgatatgatcctgagattgtgtcaagat
attgtcttggtgaaatctgaagttgcagaactcttgttccctcatgtgatggtcaatttg
tcgagtagaagagacgtggatgttgatctttgtcaactgatctcctcacaggtgcaagag
aacatttttacggaggacaataagttgaccaaatcaattcaagttatcttagatgctctt
aatgagcttcggttgtgtcacgtgatggaaagaagcacatcctctaatccctctaagcga
gaaaattcaaagcaatatggaaggccttctagctatggatcaaagtcacgctccatgcct
ctgaaggcaaagcatcagacaaccacttcatctgtagtatcaatatccacattgtcttgg
gaaaaggtttattggatatctatggattatcttgctgttgcaaggtctgctattacttct
ggtgcttactttactgctgttctttacgtggaacactggtgtgaagagaatttcaattcc
ctgacattgggcactccagatttctctcatgttgagattttgccgcggcacattgaaata
cttttatctgcagtgacacaaataaatgaacctgacagcctctatggaatcatccaatcc
cacaagttgacctctcaaattatcacatttgaacatgagggaaattggagtaaagctctt
gagtactatgatttacaaattagatctgatccagtggctcaaggaagcagttgtactcct
gaaaattttcttcattcatctgggtccgcagtagatcagatgatcgaaaagaaaccatat
aagggccttattagatccttgcagcaaattggttgcactcatcttttggatgtgtactgc
caagggttaacctctcaaaaaggaagatttcaacatgattcggagttcactgagctacag
tatgaagctgcttggcgttctggaaattgggatttctcactactttatggtgaatccagt
gtcctctcaattcagcatggaggtgaccatttcaatgaaaatctccacagctgcttgaga
gcattaaaagagggaggatttgatgaattccagataaaattaaaagattccaagcaggag
cttttgctgtctatctgtcatgcaagtgcggagagcaccaaatacatttatcaagctata
gttaagcttcagatactttatcacctcgggatgacatgggattcacggtggacttcatct
tgcacaatgctggattctttgaagatgccaaaggtctcatctaaacctgtactcccatca
attactcagttgtcatggctagacatggactggaagcgcactttgaagcaagcacagtta
catatgaatttgctggaaccatttgtggcgtttagaagagttttgcttcatattttaaat
tgccaggattatactgtacaacatctgcttgaatctgcagctactctccgcaaggtggct
aggttttctcaggctgcttcagctttgcatgaattcaagtttctctgtgcagaaatggga
gaacattccaacctttactggcttggacggcttgaagaagctaagcttctgcgtgctcaa
ggccaacatcagatggcaatcaatcttgcaaagtatatttcactaaaccaccagacgaat
gaaaacgcatctgatgttttccggttaattgggaagtggctcgctgaaacacgatcaagc
aactcaagaactatactagagaaatacttgaagcatgcagtccttctagctgaggattgc
atggcacaaggaaaggtttccgccataaaacgaagtcaactgcatttccatcttgcgcac
tatgcggatgctctgtttcgtagttatgaagaacgacttaattccagtgaatggcaggca
gcaatgcggttaagaaagcacaagacaagggagctggaagcattagttaaacgattaaga
agttcaacaaagggagaaaagaccgacttatcagcaaaaatacaagagttgcagaagcag
ctggcaatggacaaagaagaggctgaaaagttgcaggaagacagggacaactttctgagc
acagcgcttgatgaatataaacgctgtttagtaataggagataaatatgatgtcagggtg
gtatttcgacttatttcgctgtggtttggtctctcatttagaccaattgttgtggatagc
atgctcggcacaataagtgaggttcaatcttacaagtttattccactagtttaccaaatt
gcttcaaggatgggaagcacgaaagaaagtcagggagctcaaaacttccagtttgctttg
gtttctctcatcaaaagaatggccattgaccatccatatcatacgatatttcagcttcta
gctttggcaaatggtgatcgaatcaaagacaaacaacgtagcagaagttcttttgtggtt
gacatggataaaaaagtcgctgcagaaaatctgctgaaggagttatcttcgtatcatgga
gctgtcatcagacagatgaagcaaatggttgagatctacattaaactagctgaattagaa
acaaaaagggaggatactaacaaaaaggttaatcttccgagggaaattcgcagcatccga
gatcttgaacttgttcctgtggtaacagccaatatagcaattgacccgagttgtcaatac
actgaaggctcctttccgcactttaaaggattagcagattctgtcactgtgatgaatggt
ataaatgcgccaaaagttgttgaatgctttggctccgatggcaataaataccgacaactt
gcgaaatctggcaatgatgacctgagacaagatgctgtgatggaacagttctttggctta
gtaaatactttcttacagaaccatcgggacacttggaaaagaaggctgagaattcgcact
tacaaggttgtaccttttactccaagtgcgggtgttttggaatgggtgaatggcactctt
ccactcggtgaatatcttataggcagcactagagatgcaggagcccatggacgctatgga
gcaggagactggacattcatgaaatgccggcaacacatgactgtggaaagtaacaagcgg
aaggccttccaggaagtctgtgataacttcaggcctgtcatgcatcactttttcttggag
agattttttcatccagctgactggtttcaaaagaggcttgcttataccagaagcgtggcc
gcaagttcaatggtcggatatattgttggactaggagatcggcattccatgaatatcctt
gtagatcaagccactgcagaagttgttcacatagatcttggggttgcatttgagcagggc
cttatgctgaaaactcccgaaagggtaccattcaggctgagtagggacattattgatggc
atgggcgtaactggggtggaaggggtttttagaagatgctgtgaggaaaccctgtctgtt
atgcggacaaacaaagaagcactgcttaccattatcgaggtctttatccatgatccttta
tacaagtgggctttatcccctctaaaggctttgcaacgtcagaaggaaagtgaagatgat
ctggaaaccagtttggaagactctcaacgagatgactatgaggggaacaaggatgctgct
agagccttgatgcgtgttaaacaaaagttagatggatatgaagaaggtgaaatgagaagt
gttcatgggcaggttcaacaactcatacacgacgccattgatcctgatcgtttgtgtcat
ctgtttcctggatggggagcttggctatga

DBGET integrated database retrieval system