KEGG   Nicotiana attenuata: 109206651Help
Entry
109206651         CDS       T05870                                 

Definition
(RefSeq) nitrilase-like protein 2 isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109206651
Enzymes [BR:nau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     109206651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 109206651
NCBI-ProteinID: XP_019225036
LinkDB All DBs
Position
Unknown
AA seq 313 aa AA seqDB search
MNFCLNTQLSTRYNFTVASAGKSIAMANSVRVAAAQMTSVNNLAVNFATCSRLVKEAASA
GAKLLCFPENFSFVGDLQGESLKIAETLDGPIMTGYRSLARESNIWLSLGGFQEKGSDDA
HLRNTHVLIDDNGNIRSTYSKMHLFDVDVPGGAVYKESSFTEAGNDIVVADSACGRLGLT
VCYDLRFPELYQQLRFNHDAQVLLVPAAFTTVTGQAHWEILLRARAIETQCYVWPSSVLV
IAAAQAGKHNEKRESYGDTLIIDPWGTIVGRLSDRTSTGITVADIDFSLIDSVQAKMPVS
KHRKPAEFWNQHP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctgtctgaatacacaattaagcacccgttacaacttcacagtggcatctgcc
ggaaaatccatagccatggccaactccgttagagtcgccgctgctcagatgacgtccgtt
aataatctcgccgttaacttcgctacttgctctcgcctcgttaaggaagcagcttcagca
ggggctaaattgctatgttttcctgaaaatttctcttttgtgggagacctacagggagag
agtcttaaaattgctgagaccctagatggacctattatgacaggctatcgttctcttgca
agggaatcaaatatttggttgtcgctaggaggattccaagaaaaagggagtgatgatgca
cacttgcgcaacactcatgttctcattgatgataatggaaatattaggagcacgtacagt
aagatgcatctatttgacgtggatgttcctggaggtgcagtttataaagagagcagtttc
actgaagctggaaatgatattgttgtggcggacagcgcttgcggacgtttaggtctcacc
gtttgctacgatttaagattccctgaactgtatcaacagctgaggttcaatcatgatgca
caggttttgttagtgcctgccgctttcacaacggtgactggtcaggcacattgggagata
cttcttcgtgctcgtgcaattgaaacacagtgttatgtatggccatcatctgttttagtc
atagctgctgctcaagcagggaagcataatgaaaaaagggaaagctatggagatacctta
ataattgatccgtggggaacaatagttggtcggttatcagatcggacgtcaacaggtatt
actgttgcagatattgacttctcattaatagattcagtccaagcaaagatgccagtgtct
aagcatcgcaagcctgctgaattctggaatcaacatccataa

DBGET integrated database retrieval system