KEGG   Nicotiana attenuata: 109209205Help
Entry
109209205         CDS       T05870                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nau  Nicotiana attenuata
Pathway
nau00250  Alanine, aspartate and glutamate metabolism
nau00410  beta-Alanine metabolism
nau00430  Taurine and hypotaurine metabolism
nau00650  Butanoate metabolism
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Module
nau_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109209205
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109209205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109209205
   00430 Taurine and hypotaurine metabolism
    109209205
Enzymes [BR:nau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109209205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 109209205
NCBI-ProteinID: XP_019227969
UniProt: A0A314KNX1
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MVLSKAASENDVSVHSTFASRYVRVSLPRFQMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEEETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCQENARVLKEGLEK
TGKFNIVSKEIGVPLVAFSLKDNSKHNEFEVSDHLRRFGWIVPAYTMPPNAEHVTVLRVV
IREDFSRTLAERLVADIQKVLHELDSLPARVSAKLAAAEESSSGVHKKSAMEVQLEITNV
WKKFVAEKKKTKNVIC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaggccgcctcggagaacgatgtctccgttcattccaccttcgcttct
cgttacgttcgagtttctcttccccggtttcagatgccggagaattcaataccaaaggaa
gcagcatatcaaataataaacgatgaattaatgttggatggaaacccaaggctgaatttg
gcgtcatttgtgacgacgtggatggaaccagagtgtgataagctaatcatggctgccatt
aacaagaattatgttgacatggatgaatatcctgtcaccactgagcttcagaatcgatgt
gtaaacatgatagcacatttatttaatgcaccattgggagaggaagagactgcagttgga
gttggaactgttggatcctcagaagccataatgcttgctggattagcatttaagagaaaa
tggcaaaacaaaatgaaagcccaaggaaaaccctttgacaagcccaatattgttactggg
gccaatgtccaggtatgttgggagaaatttgctaggtatttcgaagtagagctaaaggaa
gtgaaattagaggatgggtactacgttatggaccctgagaaagctgtagaaatggtggat
gagaacactatttgtgtagctgctatcttgggttctacccttaatggagaatttgaagat
gttaaacgtttgaatgatcttttggtcgagaagaacaaagaaacggggtgggacactcca
atccatgtggatgcagcaagtggtggattcattgccccattcctctatccagaacttgaa
tgggatttcagattaccattagtaaaaagtattaatgtaagtggtcacaaatatggtctt
gtttatgctggtattggttgggttatttggaggaacaaagaagatttgcctgaagagctt
atcttccacattaattatcttggtgctgatcaacctactttcacccttaacttctctaaa
ggttctagtcaagtaattgctcaatattatcaacttattcgcttaggctatgagggatat
aggaatattatggagaattgtcaagaaaatgcgagggtactcaaagaaggacttgaaaag
acaggaaaattcaacatagtttccaaagaaattggagttccattagtagcattctctctc
aaagacaatagcaaacacaacgaattcgaggtttccgaccatcttaggaggttcggatgg
attgtgccagcatacacaatgccacccaacgctgagcatgtgaccgtgctcagggttgtg
atccgggaagatttctcccgaacactagctgagaggctcgtggcggacattcaaaaagtc
ctccacgagctcgactcgctcccagctagagtctcggctaagttggctgcggccgaggag
agtagcagtggagtgcataagaaatctgcaatggaagtgcaattggagatcaccaatgta
tggaagaaatttgttgccgaaaagaagaagacaaaaaatgttatatgttaa

DBGET integrated database retrieval system