KEGG   Nicotiana attenuata: 109213745Help
Entry
109213745         CDS       T05870                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nau  Nicotiana attenuata
Pathway
nau00040  Pentose and glucuronate interconversions
nau00051  Fructose and mannose metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109213745
   00051 Fructose and mannose metabolism
    109213745
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109213745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Sacchrp_dh_NADP Methyltransf_25 UDPG_MGDP_dh_N AlaDh_PNT_C DUF3829
Motif
Other DBs
NCBI-GeneID: 109213745
NCBI-ProteinID: XP_019233121
UniProt: A0A1J6KBZ2
LinkDB All DBs
Position
Unknown
AA seq 359 aa AA seqDB search
MGKGGKSNEVEENMAAWLLGVNTLKIQPFNLPPLGPHDVRVRMKAVGICGSDVHYLKTLR
CADFVVKEPMVIGHECAGIIEEVGSEVKTLVRGDRVALEPGISCWRCDLCKEGRYNLCPE
MKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANVGPETNI
LVLGAGPIGLVTLLAARAFGAPRIVIVDVDDYRLSVAKKLGADDIVKVSTNIQDVAAEIE
NIQKAMGAGIDVSFDCAGFNKTMSTALGATRPGGKVCLVGMGHHEMTVPLTPAAAREVDV
IGIFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSAGGGDAIKVMFNL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggaggaaaaagtaatgaggttgaagaaaacatggctgcttggcttcttggt
gttaacactctcaagattcaacctttcaatctccctcctttgggaccacatgatgttaga
gttaggatgaaagctgttggtatttgtggaagtgatgttcactacctcaagaccttgaga
tgtgctgattttgtggttaaagaaccaatggtgatcgggcacgaatgtgctgggatcata
gaggaagttggtagtgaagtcaagacattggttcgtggggatcgtgtggcactagagccc
ggaattagttgctggagatgtgatctttgcaaagaaggtcgatataatctgtgccctgaa
atgaagttctttgccactcctcctgttcatggctctctcgcgaatcaggtagtccatcct
gcagatctatgtttcaagctcccggataatgtaagtttggaggaaggagcaatgtgtgag
ccacttagtgttggtgtccatgcttgtcggcgtgcaaatgttggtcctgagacaaacata
ttagtgctgggagctggaccaattgggcttgtcacactgctcgcagctcgtgcttttggt
gccccaagaattgttattgtcgacgtggatgactatcgtctttctgttgcaaagaagtta
ggagcagatgacattgtcaaggtctcaactaatattcaggatgtagctgcagaaatagaa
aacattcagaaagctatgggagctgggatcgacgtgagttttgattgtgctggctttaac
aaaaccatgtcaaccgctcttggtgcaactcgtccaggcggcaaagtttgcttagtagga
atgggacatcatgagatgactgttcctcttactccagctgctgcaagggaggttgatgtc
ataggcatattccgctacaagaatacatggcctctgtgtctcgagttcttaagaagtgga
aaaatcgacgtgaaacctttgatcacacacaggtttggattctctcaaaaggaagttgaa
gaagcttttgaaactagtgctggtggtggtgatgctattaaagtcatgtttaatctgtaa

DBGET integrated database retrieval system