KEGG   Nicotiana attenuata: 109215933Help
Entry
109215933         CDS       T05870                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nau  Nicotiana attenuata
Pathway
nau03030  DNA replication
nau03410  Base excision repair
nau03420  Nucleotide excision repair
nau03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109215933
   03410 Base excision repair
    109215933
   03420 Nucleotide excision repair
    109215933
   03430 Mismatch repair
    109215933
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nau03032]
    109215933
   03400 DNA repair and recombination proteins [BR:nau03400]
    109215933
Enzymes [BR:nau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109215933
    6.5.1.6  DNA ligase (ATP or NAD+)
     109215933
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109215933
DNA replication proteins [BR:nau03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109215933
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109215933
DNA repair and recombination proteins [BR:nau03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109215933
   NER (nucleotide excision repair)
    Other NER factors
     109215933
   MMR (mismatch excision repair)
    Other MMR factors
     109215933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 109215933
NCBI-ProteinID: XP_019235601
UniProt: A0A1J6K5X6
LinkDB All DBs
Position
Unknown
AA seq 775 aa AA seqDB search
MLPLRSCCHHFTQPSLYNRLLFSLKPSSVFLLISPFNPLKTLTPLFLNPNSRTMSTRPSA
FDVLMANSKKKTPTQDSSPKKRKTPEAETSNKTAILENHNQDSVLKPNEDTHLVNESKSE
EVLVKKQKMISPDESVTELKKKAASFDPRKAAYWRDGERVPFMFVVKAFDAISKESGRIV
ITEIVTNMLRTVIETTPEDLLPVVYLSANKIAAAHDGLELGIGDASIIKALAEACGTKEA
HIKKQYKELGDLGLVAKASRSSQPLMRKPEALTVAKVFDTFRIIAKESGKDSQEKKKNYI
KSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLVALAHASVYSDKHSSPPAGLDSPLEEA
AKIVKQVYSVIPVYEKVVPALLADGVWKLSETCNFSPGVPVGPMLAKPTKGVSEILDKFQ
DMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAERNTGKFPDVVAAISRLKKSSATSFVLD
CELVAYDREKQKILPFQILSTRARKNVVMSDIKVNVCIYAFDILYLNGQPLLQEQLNVRR
EHLYKSFEEEPGYFQFATAVTSNDLEEITKFLEAAVNDSNEGLIIKTLSRDATYEPSKRS
NNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGGYGAFLLACYDSNNEEFQSICKIGTG
FSEAMLEERSSSLRSKVIPKPKSYYRYAETINPDVWFEPTEVWEVKAADLTISPVHRAAQ
GIVDRDKGISLRFPRLIRVREDKNPEQASSADMVADMFNAQKHNHKNDKDDNEED
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttgcgctcatgctgtcaccatttcactcaaccttctctttacaaccgtctc
cttttctcccttaaaccctcttcagtctttctccttatatccccctttaatccccttaaa
acccttacaccccttttcctaaaccctaattcaagaaccatgtccactcgtccctctgct
ttcgatgtccttatggcaaattccaagaaaaaaaccccaacacaagattcttcacccaag
aaacgcaaaaccccagaagctgaaacttctaataaaactgctattctcgaaaatcataat
caagattcagttttgaagccaaatgaggacacccatttggttaatgagtcgaaaagtgaa
gaggttttggtgaagaaacagaagatgataagtccagatgagagtgtgactgagctgaag
aaaaaagccgctagctttgatccaagaaaggctgcatattggagggatggtgagagagtg
ccattcatgtttgtagttaaggcgttcgatgcgatttcgaaggagtcaggaagaattgta
attactgaaattgtgactaatatgttgaggactgtgattgagacgacgcccgaggatttg
ttgcctgttgtgtacctttcggctaacaagattgcagctgcacatgatggtttggagctt
ggtattggagatgcttcgattatcaaggcacttgctgaagcttgtggcactaaagaagca
catattaagaagcaatataaggagcttggagacttgggccttgttgcaaaagcaagccgc
tcatcacaacctctgatgcgaaaaccagaagcattgactgttgctaaagtttttgacacg
tttcggattattgccaaggaatctgggaaggatagtcaggaaaagaaaaagaattacatt
aaatcactacttgttgcagctactgattgtgaaccccaatatttgattcgtctcctccag
acaaagctacgcattggtttggctgaacaaacactcttagtcgcacttgctcatgcttct
gtgtactcagataagcattcatcacctcctgcaggtctagattctcctttggaagaggct
gccaagattgtaaagcaagtgtactctgtaattccggtttatgaaaaagttgttcctgct
cttctagctgatggtgtttggaagctttcagaaacatgcaacttctcacctggtgttccg
gttggacctatgctagctaagccaaccaaaggagtatctgaaattcttgataagtttcag
gatatggagttcacatgtgaatacaagtatgacggtgaacgtgctcagatacactacatg
gaagatggttctgttgagatatacagccgaaatgcagaaagaaatactggaaaatttccc
gacgttgttgctgctatctcaagattgaagaaatcttctgcaacatcatttgttcttgat
tgtgaactggtcgcatatgaccgtgagaaacagaagatcctgccctttcagatcctcagt
acgcgtgctcgtaagaatgttgtcatgagtgatatcaaggtcaacgtttgcatatatgct
tttgatatcttgtatcttaacggacaaccacttcttcaagagcaacttaatgttcgcaga
gagcatctttacaagtcatttgaagaagaacccggatatttccaatttgctacagctgta
acctcaaacgatcttgaggaaataacgaaatttcttgaagctgcagtgaatgacagtaat
gagggattgataatcaagacactaagtagagatgctacatatgagccttcaaagcggtca
aataactggctaaaactgaagaaggactacatggaaagtattggcgactcactggatttg
gtaccaattgctgcttttcatggtcgggggaaacgtactggtggttacggagcctttctc
ctagcttgttatgatagcaacaacgaggagttccagagcatctgtaaaattggaactgga
ttttctgaagcaatgcttgaagaacgctcttccagccttcgttccaaagttattccgaaa
ccaaagtcatattacaggtatgcggaaaccatcaatccagatgtatggtttgaacctacc
gaggtatgggaagtgaaagcagctgatcttaccatcagccctgtccaccgtgctgcgcaa
ggtatcgtggatcgcgataagggaatatctttaagatttccacgtttgattcgtgtacga
gaagacaagaatcccgaacaggcctcatcagcagacatggtcgcggatatgttcaatgca
cagaagcacaatcataaaaatgataaggatgataatgaagaagactaa

DBGET integrated database retrieval system