KEGG   Nicotiana attenuata: 109217105Help
Entry
109217105         CDS       T05870                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nau  Nicotiana attenuata
Pathway
nau00010  Glycolysis / Gluconeogenesis
nau00051  Fructose and mannose metabolism
nau00052  Galactose metabolism
nau00500  Starch and sucrose metabolism
nau00520  Amino sugar and nucleotide sugar metabolism
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
nau01200  Carbon metabolism
Module
nau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nau_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109217105
   00051 Fructose and mannose metabolism
    109217105
   00052 Galactose metabolism
    109217105
   00500 Starch and sucrose metabolism
    109217105
   00520 Amino sugar and nucleotide sugar metabolism
    109217105
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109217105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nau04131]
    109217105
Enzymes [BR:nau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109217105
Membrane trafficking [BR:nau04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109217105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 NleF_casp_inhib
Motif
Other DBs
NCBI-GeneID: 109217105
NCBI-ProteinID: XP_019236910
UniProt: A0A1J6J4D4
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MRKEVVVLEAVTTVSTAVAAALLVRQWKRRSEQRWRHAQRILRKFARECATPVPKLWQIA
DDLVTEMQSGLTSTESSLQMLPSCLASLPTGDEKGLYYGINLRGTNFIIVQARLGGRNEP
PVSRLAGRNEPISDLYRQEIQIPPNIIEGSSQELFDWITVELGKFISMHSEGLQGGEKNL
GFTVSPTIGEVAASKETAIKWKDSLFGDAEGNKLLNEINLALEKHGVDKQVFALVDDTIG
VLAGGRYYSKESVAAVTLGMGTNAAYVESAKSVVKWPDQAPKPEEIAINIQWGNFRSSHL
PITEFDTSLDAESSNPGSQIFEKLISGTYLGETVRRVILKMAQESSLFGDRVPPNLAIPY
SLRSPDMAAMHQDTSEDYEVIDEKLTEIFGINNSTTMARELVAEVCDVVAERGARLVGAG
IVGIVKKLGRLSNRISIITVEGGVYEHYRVFRNYLHSSVWEMLGNELSDNVIIEHSHGGS
GASSIFIAASQP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggaggtggtggtgttggaagcagtgacgacggtttccaccgccgtagcggct
gcgctgttggtgaggcaatggaagaggcgaagcgagcaacggtggaggcatgcacagcgt
atccttcgaaaatttgcaagagaatgtgcgacccctgttcctaagttatggcaaattgct
gatgatctcgtgactgagatgcaatcgggtctaacttcaactgaatccagcctccaaatg
cttccttcttgcttagcttcactacccacaggagatgagaaaggtctatactatgggatt
aatcttcgcggaactaatttcatcatcgtgcaagcacgtcttggaggaagaaatgaacca
cccgtttcacgtcttgctggaagaaatgaacccatttcggatctttataggcaagaaatt
caaattcctcccaacataatagagggcagctcccaggaattatttgattggataacggtg
gagctcgggaaattcatctccatgcatagtgaaggtctgcaaggaggagagaaaaatctg
ggatttactgtatcacctacaattggggaagtagctgcctccaaggaaacagccattaaa
tggaaggattcattatttggagacgcagaagggaacaagttgttgaatgaaatcaatctc
gccttggagaagcacggtgttgataagcaagtttttgccctggttgatgacaccatagga
gttttggctggaggaaggtactatagtaaagagagtgtggctgcagtcactctgggaatg
ggcactaatgctgcgtatgtagaatcagcaaaatccgttgtaaaatggcctgatcaggct
ccaaaaccagaagaaatagcaattaatatccaatgggggaattttaggtcctcccatctt
ccaattaccgaatttgatacatcgttagatgccgaaagttcaaatcctggtagccagata
tttgagaagcttatttcgggtacatatttaggagaaactgttagaagagtcatactaaag
atggctcaggaatcatctttatttggagatagagtaccacctaacctagcaattccatac
tcgttgaggtccccagatatggctgctatgcatcaagacacatcagaggactatgaagta
attgatgagaaactgacagaaatttttgggataaataactctacaaccatggcaagagaa
ctagttgcagaggtctgtgatgttgtagcagaacgtggagctcgattagttggagctggc
atcgtggggattgtaaagaaactaggaaggctttctaataggattagcattattacagta
gaaggtggtgtctacgagcattatcgcgttttcaggaactatctgcatagcagtgtgtgg
gagatgcttggcaatgaactatcagacaatgtgattattgaacattctcatggtggttct
ggtgccagttccatctttattgcagcttcacaaccataa

DBGET integrated database retrieval system