KEGG   Nicotiana attenuata: 109225796Help
Entry
109225796         CDS       T05870                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nau  Nicotiana attenuata
Pathway
nau00040  Pentose and glucuronate interconversions
nau00051  Fructose and mannose metabolism
nau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109225796
   00051 Fructose and mannose metabolism
    109225796
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109225796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N Pyr_redox_3 AlaDh_PNT_C Pyr_redox_2 Methyltransf_25 Sacchrp_dh_NADP DAO
Motif
Other DBs
NCBI-GeneID: 109225796
NCBI-ProteinID: XP_019246119
UniProt: A0A1J6IGJ6
LinkDB All DBs
Position
5
AA seq 367 aa AA seqDB search
MVIKEHISTDDAENSITEEENMAVWLLGIKTLRIQPYSLPPLGPYDVKIQIKAVGICGSD
IHHFKNMRVANFVVKRPMVLGHECAGIVEQVGSQVKSLMIGDRVALEPGISCRQCHLCKD
GRYNLCRQMKFFGSPPTNGALANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRA
KVGPETKIIIIGAGPIGLVTMLAARAFGSPKIVIVDIDDQRLSFAKDLGADEIIKVSSNV
QDVEDEVGHICNAMGGPVDMSFDCVGFNKTMLMTLQTTHPGGKVCLVGLGQSEMTLPLTS
AAAREVDVIGIFRYRNTWPLCIELLRTGKIDVKPLITHRYRFTQEGVEEAFETSSRGGNA
INVMFKL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcaaggaacacatatcaactgatgatgcagaaaacagtataacagaagaagag
aacatggcagtttggcttcttggtatcaaaacacttcgaattcagccatatagtctccca
cctcttggtccttatgatgtcaagattcaaattaaagcagtgggtatatgtggaagtgat
atccatcatttcaagaatatgagagtagcaaatttcgtggttaaaaggccgatggtactt
gggcatgagtgtgctggaattgtagagcaagttggtagccaggtgaagtccctcatgatc
ggcgatcgcgtagctttggagcctggtattagttgcaggcagtgtcacttatgcaaagac
ggtcgctacaatctctgccgtcaaatgaaattctttggctctcctccaactaatggtgct
ttagccaatcaggtggtacatcctgcagatctgtgttttaaattaccggataatgtaagc
ttggaggaaggggcaatgtgtgaacctctgagtgttggtgttcatgcttgtcgtcgtgcc
aaggtaggtccagaaaccaaaataatcattataggtgcaggacctatcggccttgtcact
atgctggcagctcgtgcttttggatcaccgaagatagtcattgttgatatagatgatcag
cgtttatcttttgccaaagaccttggtgctgatgagatcattaaagtttcttccaatgta
caggatgtggaagatgaagtgggacatatatgcaatgcaatgggaggtcctgtggatatg
agctttgattgtgttggttttaacaagactatgttgatgactctgcaaaccacccatcct
ggtggtaaggtttgcctcgttggattaggccaaagcgagatgactctccctcttacttca
gctgctgcaagggaggtggatgtcataggcattttcagatatagaaatacatggccactc
tgcattgaacttctcagaactggtaaaatagatgtgaagcctctcataacccacaggtat
aggtttactcaagagggggtggaagaagcctttgagaccagttctcgcggtggaaatgcc
atcaatgtcatgttcaaactatag

DBGET integrated database retrieval system