KEGG   Nicotiana attenuata: 109226906Help
Entry
109226906         CDS       T05870                                 

Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] reductase 4-like
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
nau  Nicotiana attenuata
Pathway
nau00061  Fatty acid biosynthesis
nau00780  Biotin metabolism
nau01100  Metabolic pathways
nau01212  Fatty acid metabolism
Module
nau_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109226906
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109226906
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    109226906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nau01004]
    109226906
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     109226906
Lipid biosynthesis proteins [BR:nau01004]
 Fatty acid synthase
  Component type
   109226906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 109226906
NCBI-ProteinID: XP_019247362
LinkDB All DBs
Position
6
AA seq 326 aa AA seqDB search
MASLAFNSVATTSKFHSSSAAAVGSSSIRRQLTHLRLPSSPLQPSPPLQCRWSSSSSSAS
SGVRAQVATTEQAGVEAAAKIEAPVVIVTGASRGIGKAIALSLGKAGCKVLVNYARSSKE
AEEVSKEIEACGGQALTFGGDVSKEEDVESMMKTVVDRWGTVDILINNAGITRDTLLMRM
KKSQWQEVIELNLTGVFLCTQAAAKIMMKKKKGRIINISSVVGLVGNAGQANYSAAKAGV
IGLTKSVAKEYASRNITVNAVAPGFIASDMTAKLSEDIEKKILQSVPLGRYGQPEEVAGL
VEFLALNPAASYITGQVLTIDGGMVM
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctcgcctttaattccgtcgcaaccacctccaaattccactcctcctccgcc
gctgccgtcggaagctcctccatccgccgccagcttacgcatctccgccttccgtcttcc
cctcttcagccatcacctcccttgcaatgccgctggtcctcttcctcttcttccgcctct
tcaggcgtgagagctcaggtggcaacaactgaacaagctggagttgaagctgctgcgaaa
attgaagctcccgttgttattgtcacgggagcttctagaggaatcgggaaggctattgca
ttgtctttgggaaaggctggttgtaaggtcctagttaactatgcaagatcttcaaaggag
gcagaagaagtctccaaagagattgaagcatgtggtggccaagccttgacttttggaggc
gatgtttcgaaagaagaagatgtagaatccatgatgaaaactgtggttgatcgatgggga
accgttgatatcttgatcaataatgcaggtatcacacgcgataccttgttgatgagaatg
aagaagtctcaatggcaggaggttattgagttgaatcttacgggagtttttctctgcaca
caggctgcagctaaaatcatgatgaaaaagaaaaagggacgaatcatcaacatatcttct
gttgttggtttagttggcaatgccgggcaagccaactacagtgctgctaaagcaggagtg
attggcttaaccaagagtgttgcaaaagaatatgcgagcaggaatattactgttaatgct
gttgcccctggatttattgcttctgatatgactgccaaactaagtgaagacattgaaaag
aaaattttgcaaagcgttcccttaggacgctacggtcaaccggaagaagttgctggatta
gtggaattcctggcactgaatcctgcagctagctatattacgggacaggttttgaccatt
gacggtgggatggttatgtag

DBGET integrated database retrieval system