KEGG   Nicotiana attenuata: 109235412Help
Entry
109235412         CDS       T05870                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nau  Nicotiana attenuata
Pathway
nau00010  Glycolysis / Gluconeogenesis
nau00053  Ascorbate and aldarate metabolism
nau00071  Fatty acid degradation
nau00280  Valine, leucine and isoleucine degradation
nau00310  Lysine degradation
nau00330  Arginine and proline metabolism
nau00340  Histidine metabolism
nau00380  Tryptophan metabolism
nau00410  beta-Alanine metabolism
nau00561  Glycerolipid metabolism
nau00620  Pyruvate metabolism
nau00903  Limonene and pinene degradation
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109235412
   00053 Ascorbate and aldarate metabolism
    109235412
   00620 Pyruvate metabolism
    109235412
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109235412
   00561 Glycerolipid metabolism
    109235412
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109235412
   00310 Lysine degradation
    109235412
   00330 Arginine and proline metabolism
    109235412
   00340 Histidine metabolism
    109235412
   00380 Tryptophan metabolism
    109235412
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109235412
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109235412
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109235412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109235412
NCBI-ProteinID: XP_019257053
UniProt: A0A1J6IE01
LinkDB All DBs
Position
12
AA seq 536 aa AA seqDB search
MAARVFASRVSRSLTSSSHLLSRGSKSHLGRIAAYQYSTAAAFEEPIKPAVNVEHTKLFI
NGEFVDAASGKTFPTLDPRTGEVIAHIAEGDAEDINRAVAAARKAFDEGPWPKMNAYERS
KILLRLADLIEKHNDQIATLETWDTGKPYEQAAKIEVPMVVRLLRYYAGWADKIHGMTIP
ADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIGPALACGNTVVLKTAEQTPLSAFYVA
HLLQEAGLPEGVLNIISGFGPTAGASLCSHMDVDKLAFTGSTDTGKAILTLAAKSNLKPV
TLELGGKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKAR
ALKRTVGDPFKSGTEQGPQIDSKQFDKIMNYIRCGINSGATLETGGERLGERGYYIKPTV
FSNVKDDMLIAQDEIFGPVQSILKFKDLDDVIRRANNSRYGLAAGVFTQNIDTANTLTRA
LRVGTVWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtgtgtttgcctcgcgtgtctctcgctctttgacatcctcttctcatctg
ctctcaagaggaagtaaatcccatctgggcagaatagctgcttatcaatacagcacggcg
gctgcttttgaggaacctatcaaaccagctgtcaatgtggaacatactaaactttttatc
aatggtgaatttgttgatgctgcatcaggaaaaacattcccgactctcgaccccaggaca
ggggaggtaattgcacatattgctgaaggtgatgcagaagatataaatcgggcagtagct
gctgctcgtaaggcttttgacgaaggaccatggcctaaaatgaatgcttatgaaaggtca
aagatattgttgcgccttgctgatctgattgaaaaacataacgatcaaattgcaacgctc
gagacttgggatactgggaaaccatatgaacaggctgctaagattgaagtaccaatggtt
gtacgtctgctccgttattatgctggctgggcagataaaattcatggtatgactattcct
gctgatggaccgtatcatgttcagacgttgcacgaaccaattggggttgctggtcagatt
atcccatggaattttcctcttctcatgttttcttggaagattggacccgctttagcttgt
gggaatactgtcgtgctaaagacagctgagcagacaccattatctgcattctatgtagca
catctattacaggaggctgggctgcctgaaggtgttttgaacatcatttctggttttggt
ccaacagctggtgcttctctttgtagtcatatggatgtggataagcttgcttttactgga
tcgacagatacaggaaaagctatacttacgttggctgctaagagcaatcttaagcctgtg
actctggaacttggagggaaatccccttttattgtttgtgaggatgctgatattgatacg
gccgttgaacaagctcactttgctctcttctttaatcaggggcaatgttgctgtgctgga
tctcggacttatgttcacgagaaagtttatgatgaatttctggagaaggcaaaggcacgt
gccttgaaacgcacagttggtgatccgtttaaatcaggcaccgagcagggtcctcagatt
gattcaaaacagtttgataagatcatgaattacattagatgtggtatcaatagtggagca
actcttgaaactggaggtgagcgacttggtgaacggggatactatattaagcccacagtt
ttctctaacgttaaggacgatatgctgattgcacaagatgaaatttttggtccagtgcag
tccatcttaaaatttaaggatcttgatgatgtgatacggagagctaataacagtcggtat
ggtctagctgctggagtatttacacagaacattgacactgcaaacacattgacacgagcc
ttgagagtgggaacggtatgggttaattgctttgataccttcgatgctacaattcctttt
ggtggctataagatgagtggacacggaagagaaaagggagaatacagtctcaagaattac
ttgcaagtaaaggcagttgtgaccccattgaagaatccagcatggttataa

DBGET integrated database retrieval system