KEGG   Nicotiana attenuata: 109236471Help
Entry
109236471         CDS       T05870                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nau  Nicotiana attenuata
Pathway
nau00061  Fatty acid biosynthesis
nau00780  Biotin metabolism
nau01100  Metabolic pathways
nau01212  Fatty acid metabolism
Module
nau_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109236471
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109236471
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    109236471
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nau01004]
    109236471
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     109236471
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     109236471
Lipid biosynthesis proteins [BR:nau01004]
 Fatty acid synthase
  Component type
   109236471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 109236471
NCBI-ProteinID: XP_019258199
LinkDB All DBs
Position
Unknown
AA seq 200 aa AA seqDB search
MSEADEYLLTGPFRMDLPSFRSIGVSKPLSETSRKGYLAAVSASSYSFISLLRHFLPIIN
PGGATISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHKVRVNTISAGPLGS
RAAKAIGFIDMMINYSLENAPLQKELYAEEVGNTAAFLASTLASAITGATVYVDNGLNAM
GVGVDSPAFSGLDIPKDNKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagctgatgagtatttgctcactgggccgtttcgcatggacctgccaagtttc
aggtcaatcggagttagcaaacctctgtcggagacatcaagaaaaggataccttgcagct
gtatctgcctccagttattcctttatatctctactgaggcattttcttcctataataaat
ccaggcggtgccacaatctctctaacgtacattgcttctgaaaggattatccctggatat
ggaggcggtatgagttcggcaaaagctgctttggagagtgacactagagtcctggcgttt
gaagctggaagaaagcacaaagtcagagtgaacacgatatctgcaggtccactgggaagt
cgtgcagcaaaagctattggctttattgacatgatgataaattactcattggagaatgct
cctttgcaaaaggagttatatgccgaggaggtcgggaacactgctgcttttctggcatct
actttggcttcagcaattactggtgccaccgtgtatgttgacaatggtctgaacgcaatg
ggagttggagttgacagcccagctttttcgggtctcgatatcccaaaggataataagagt
tag

DBGET integrated database retrieval system