KEGG   Nicotiana attenuata: 109236986Help
Entry
109236986         CDS       T05870                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nau  Nicotiana attenuata
Pathway
nau04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nau00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109236986
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109236986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109236986
NCBI-ProteinID: XP_019258772
UniProt: A0A314LFG0
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MAAHTIFTSTSSTTNSLLFPITAPNTNSSPSLHSSFHGVSLNLKSKAPQSLTLSAATAPK
RLTVFAVTKKAVAVLKGNSNVEGVVTLSQDDDGPTTVKVRITGLTPGLHGFHLHEYGDTT
NGCMSTGPHFNPDGKTHGAPEDENRHAGDLGNIVANADGVAEATIVDNQIPLSGPNSVVG
RALVVHELEDDLGKGGHELSLTTGNAGGRLACGILGLTPI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccacacaatcttcacttccaccagcagcactaccaattctttgttattccca
attactgcccctaacaccaactcctccccttcactccactcttctttccacggtgtttcc
ctcaatctcaagtcaaaggccccccaatctttgacactttctgctgccactgctcctaaa
cgtctcactgtttttgctgttactaagaaagctgttgctgtccttaagggcaattccaat
gttgagggcgttgtcactctctcccaagatgatgatggtccaactactgtgaaagtacgc
ataactggacttactcctgggcttcatggtttccatttacacgagtacggtgacactaca
aacgggtgtatgtctacaggaccccatttcaatcctgatggcaagactcatggagctcct
gaagatgaaaaccgtcatgcgggtgacctgggaaacatagtagccaatgccgatggtgtg
gctgaagcaacaattgtagataatcagataccattgtctggtccaaactcagttgttgga
agagcgcttgtggttcatgagcttgaggatgacttgggaaagggtgggcatgaactcagc
cttaccactgggaatgctggtggacgattggcatgtggcatacttggtttgactccaata
tga

DBGET integrated database retrieval system