KEGG   Nicotiana attenuata: 109244493Help
Entry
109244493         CDS       T05870                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nau  Nicotiana attenuata
Pathway
nau00020  Citrate cycle (TCA cycle)
nau00190  Oxidative phosphorylation
nau01100  Metabolic pathways
nau01110  Biosynthesis of secondary metabolites
nau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109244493
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109244493
Enzymes [BR:nau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109244493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 109244493
NCBI-ProteinID: XP_019267136
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQAVRLIFCYHTYDAVVVGAGGAGLRAAIGLS
EHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQY
MCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALL
HTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAASTILATGGYG
RAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRN
SEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERL
PGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVPGLMAAG
EAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAWLDKI
RNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRSLIWN
SDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVR
LEYRPVHMNTLDDEVETFPPKARVY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgtgtgtcgcgtggccttcgcgcttcctctaacagatctatctccggcggc
ggccattttcgccgacttttctcctcacaggctgtacgcttgatcttctgctatcacaca
tacgatgcagtggtggtaggtgcaggtggtgcagggcttcgagcggcaatagggttgtct
gagcatggattcaatactgcttgcataaccaagctctttcctactcgatctcacaccgtt
gcagctcagggcggtataaatgcagcattaggcaatatgacagaggacgattggaggtgg
cacatgtatgatacagttaaaggaagtgattggttaggtgatcaggatgctatccaatac
atgtgtagagaagcgcccaaagcagttatagagcttgagaattatggtttgcctttctct
cgaactgaagatggtaaaatatatcaacgtgcatttggtggtcaaagcctagactttgga
aaaggaggacaagcatatcgttgtgcttgtgctgccgatcggactgggcatgctctattg
catactctttatgggcaggccatgaagcataatacacagtttttcgtggaatattttgct
ttggatttactaatgaacagtgatgggagctgccaaggtgtaatagcactaaatatggag
gatggtaccttgcatcggttccgtgctgcctctactattttggccacagggggttatggt
cgagcttacttctctgcaacatctgctcatacttgcaccggagatggtaatgctatggtc
gcgcgtgctgggcttcctcttgaggatcttgagtttgtgcagtttcatccaactggtata
tatggagctggttgtctcattactgaaggatctcgtggtgaaggtggtattctgaggaat
agtgagggtgagcgatttatggaaaggtatgccccaacagccaaggatcttgcgtcaaga
gatgttgtttccagatctatgacaatggaaattcgagaagggcgtggtgtaggaccattg
aaggatcatatctatcttcacctcaatcacttacctccagaggtccttaaggagagactt
cctggtatctctgaaacagctgcaatttttgctggtgttgatgtaactaaggagccaatt
cccgttttacctaccgtgcattataatatgggaggaattcccacaaattaccatggagag
gtggtcactattaaaggagataatcctgatgccgtggttcctggactgatggctgctggt
gaagcagcatgtgcatcagttcatggtgccaatcgtcttggtgcaaattctcttctagat
attgttgtttttgggcgggcatgtgctaatagggttgctgaaatccaaagaccaggagag
aaccagaagccacttgagaaggatgcgggagagaggaccattgcatggttggacaagatt
aggaactcaaatggttcactgcctacatcaaagattcggctgaatatgcagagagttatg
caaaacaatgctgctgtgttccgcacacaagaaacactagaggaaggttgccagctcatt
gacaaaacatgggagagtttccatgatgttcagttgaaggatagaagtttaatatggaac
tcagatcttatagagactattgagctggaaaaccttttgatcaatgcatgcatcaccatg
cactcagccgaggctagaaaagaaagcagaggagctcatgctcgtgaagattttacgaaa
agagatgatgagaagtggatgaaacatacactaggatattgggagaatgagaaggtccgg
ctagagtacagaccagttcatatgaacactctagatgacgaggtcgagacattcccacct
aaggcacgtgtctattga

DBGET integrated database retrieval system