KEGG   Natrialbaceae archaeon XQ-INN 246: HC341_11690
Entry
HC341_11690       CDS       T06517                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
nax  Natrialbaceae archaeon XQ-INN 246
Pathway
nax03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HC341_11690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nax02044]
    HC341_11690
Secretion system [BR:nax02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HC341_11690
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: QIT55813
LinkDB
Position
complement(2498017..2499051)
AA seq 344 aa
MDDDRTIIRPRPGGSRGSGGGAGIRPRPAPSSAAGNDATVLRGRARREPVRLRDVATLRD
GALAGLATPLLSLTVQLGQLQDPVGEAGLHQQVMDAVRRFQERAREAGFSASRVERASYL
LCSFIDETVLNSPWGEQSNWSQKTALRAFHNETDGGEQVFRMIDRELESARRDHDFLELA
YLCLSLGLKGRYRVDADGAVRLEEIRQSLYGVLHHTRDRRRDALSPEVEPAAGVVHRLHS
FLPVWVLASVLGLAAFALYSLLLFDLNRHADTVGASLAGLVPPTEVQEASAEPDGALAGR
LRELMAPEIDQGLVAVQETGSRTMVVLESEDLFDSASATVNPSP
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggacgacgacagaaccatcattcgcccgcggccgggtggctccaggggcagcggcggt
ggtgccggtatacggccccgcccggcgccctcgtctgcggcggggaacgacgccaccgtg
ctacgcggccgggcgcgccgcgagcccgtgcgcctgcgtgatgttgccacccttcgcgac
ggtgcgttggccgggctggccacgccgctgctgtcgctgacggtacaactcgggcagttg
caggatcccgtgggtgaagcggggctgcatcagcaggtgatggacgccgtgcggcggttc
caggagcgtgcgcgggaggccggcttctctgcgtcccgggtggagcgggcgagctacctg
ctgtgctcgttcatcgacgagaccgtgctcaacagtccctggggtgaacagagcaactgg
agccagaagacagcgctgcgcgccttccacaacgagactgacggcggtgagcaggtgttc
cgcatgatcgaccgcgagctggaaagcgcgcgacgtgatcacgatttcctggaactggcc
tatctgtgcctgtcgctggggctcaaggggcgctatcgcgtggatgccgacggcgccgtg
cggcttgaggagattcgccagtccctctacggcgtgctccatcacacccgtgaccgcagg
cgggatgctctgtcgccggaggtggagccggcggcgggggtggtgcatcggctgcacagt
tttctgccggtctgggtgctggcaagcgttcttggcctggcggccttcgcgctctactcg
ctgcttctgttcgatctcaatcgtcatgccgacaccgtcggcgccagccttgccgggctg
gtgccgccgacggaggtgcaggaggcgtcagcagagccggacggtgcgctggccgggcgc
ctgcgggaactcatggcaccggagatcgatcagggcctggtcgccgtgcaggagacaggc
tcgcgcacaatggtggtgctggagagcgaggaccttttcgactctgccagcgcaacggtg
aatccctccccatga

DBGET integrated database retrieval system