KEGG   'Nostoc azollae' 0708: Aazo_0404Help
Entry
Aazo_0404         CDS       T01260                                 

Definition
(GenBank) 2-methylcitrate synthase/citrate synthase II
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00020  Citrate cycle (TCA cycle)
naz00630  Glyoxylate and dicarboxylate metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
naz01210  2-Oxocarboxylic acid metabolism
naz01230  Biosynthesis of amino acids
Module
naz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aazo_0404
   00630 Glyoxylate and dicarboxylate metabolism
    Aazo_0404
Enzymes [BR:naz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Aazo_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ADI62961
UniProt: D7DZK9
LinkDB All DBs
Position
complement(405667..406803)
Genome map
AA seq 378 aa AA seqDB search
MTVCEYKPGLEGIPAAQSSISYVDGQKGILEYRGIRIEELAERSTFLETAYLLIWGELPN
KEELAAFEDEVCTHRRIKYRIRDMMKCFPESGHPMDALQASAAALGLFYSRRDLHNPVYI
RNAVVRLVAIIPTMVAAFQLMRKGNDPVKPRDDLDYAANFLYMLNEKEPDPLAARIFDIC
LILHVEHTMNASTFSARVTASTLTDPYAVVASAVGTLGGPLHGGANEEVIEMLEEISCVD
NVRSYIEDRLQKKAKIMGFGHRVYKVKDPRATILQRLAEQLFDKFGYDKYYEVAQEVEWV
MAEKVGSKGIYPNVDFYSGLVYRKMGIPTDLFTPVFAIARVAGWLAHWKEQLAENRIFRP
TQVYNGRHEITYTPIDKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgtgcgaatacaagcctggtttagaaggcattcccgcagcccaatcgagtatt
agttatgtagatgggcaaaagggaatactggagtatcgtggcattcggattgaggaatta
gcagaaagaagtacattcttagaaactgcttatctcttaatctggggtgaattgccaaac
aaggaagaattggcggcttttgaagatgaagtttgtacccacaggcggataaaataccgc
attcgggatatgatgaaatgcttccccgaaagcggtcatccaatggatgctctacaagcc
tctgctgctgccttgggtttattttattctcgtcgtgacttacataaccctgtctatatt
cggaatgcagtagtacgtttagtagcgataattcccacaatggtagcggctttccagttg
atgcggaagggtaatgatccggtaaaaccaagggatgatttggattatgccgccaacttc
ttgtatatgctcaatgagaaagaacccgatccgttagcagcgcgaatttttgacatctgt
ttgattctgcacgttgagcatacaatgaatgcttctaccttcagtgcgagagttacagct
tctaccttaactgacccttatgctgtggttgccagtgcggtaggtactttaggcggtccg
ctgcatggtggtgctaacgaagaagttattgagatgttggaagaaattagctgtgtggat
aatgtccgttcctacatagaagatcgtctgcaaaagaaggcgaaaattatggggtttgga
caccgtgtatataaggtaaaagatccacgggcaactatcttacaacgattggcagagcaa
ctgttcgataagtttggctacgataagtattatgaagttgctcaagaagtagaatgggta
atggccgagaaagtcggcagcaaagggatttatcctaatgttgacttttactctgggctc
gtgtataggaaaatgggaattcccacggatttatttacacctgtatttgcgatcgctcgt
gtggctggttggttagcacactggaaagaacaacttgcagaaaaccggattttccgtcct
acccaagtttataacggtcgtcacgaaatcacttacactcccatcgacaagcgttaa

DBGET integrated database retrieval system