KEGG   'Nostoc azollae' 0708: Aazo_1215Help
Entry
Aazo_1215         CDS       T01260                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00020  Citrate cycle (TCA cycle)
naz00480  Glutathione metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
naz01210  2-Oxocarboxylic acid metabolism
naz01230  Biosynthesis of amino acids
Module
naz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aazo_1215
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Aazo_1215
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Aazo_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADI63526
UniProt: D7E3A3
LinkDB All DBs
Position
1295244..1296665
Genome map
AA seq 473 aa AA seqDB search
MYEKITPPTTGAKIIFKNGEPVVPDNPIIPFIRGDGTGIDIWPATEKVLDAAVAKAYKGT
RKISWFKVYAGDEACDLYGIYQYLPQDTITVIKEYGIAIKGPLTTPVGGGIRSLNVALRQ
IFDLYACVRPCRYYAGTPSPHKNPEKLDVIVYRENTEDIYLGIEWKQGSEIGDRLIKILN
EELIPATPEHGKKQIPLDAGIGIKPISKSGSQRLLRRAIKHALTLPRNKQQVTLVHKGNI
MKYTEGAFRDWGYELATTEFRNETVTERESWILGNKEKNANISLEENARMIDPGFDSLTP
EKKAQIVKEVETVLNDIWATHGNGKWKEKIMVNDRIADSIFQQIQTRPDEYSILATMNLN
GDYLSDAAAAIVGGLGMGPGANIGDSCAVFEATHGTAPKHAGLDKINPGSVILSGVMMLE
FMGWREAADLVKKGLGDAIANAQVTYDLARMIEPPVEPLKCSEFADVIIKYFS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaaagattacccctccgacgactggcgcaaaaattatcttcaaaaatggtgaa
cctgttgttcctgataatcctattatcccctttattcgcggtgatggaacaggtatagat
atttggcctgcaactgaaaaggtgcttgatgctgcagttgctaaggcatacaaaggtaca
agaaaaattagctggtttaaggtttatgctggcgatgaagcctgtgatttatacggtata
taccagtatttaccccaagatactatcacggttattaaagagtatggtattgctattaaa
ggacctttaactactccagtgggtggtgggattcgttctttaaacgtagcattacgtcag
atttttgacctgtacgcctgtgtgcgtccttgtcgttattacgctggtacgccatctcca
cacaaaaatcctgaaaaattggatgtaattgtgtatcgggaaaatacggaagatatttat
ttggggattgagtggaaacagggaagtgaaataggtgatcgcttaattaaaattctcaat
gaggaactgattcccgcaactccagaacacgggaaaaagcaaattcccctcgatgcgggt
attggtattaaacctatcagtaaaagcggttctcaacgcttacttaggcgtgctattaaa
cacgctttgactttgcccagaaataagcaacaagtaactttggtgcataagggcaacatc
atgaaatacaccgaaggcgcctttagagattggggttatgaactagcaaccaccgaattt
cgtaacgaaacggttacagaacgggaatcttggattttgggtaataaggagaaaaacgcc
aatatctccttagaagaaaacgccagaatgattgatcctggttttgattccttaactcca
gaaaaaaaagcgcaaattgtcaaggaagtggaaacagttcttaatgatatttgggcaact
cacgggaatgggaaatggaaagagaaaatcatggtcaatgatcgcattgccgatagtatc
tttcaacaaatccaaactagaccagatgagtattctattctggcgacaatgaacctcaac
ggtgactatttatctgatgctgctgcggcgatcgtcggtggtttaggcatgggtccaggg
gcaaatattggcgactcctgcgcggtttttgaagccactcatggtacagcacccaaacac
gctggtttagataaaattaaccccggttctgtgatactttccggtgtgatgatgctggaa
tttatgggttggcgagaagccgcagacttggtaaaaaagggtttaggggatgcgatcgcc
aatgctcaagtcacctacgacctagcgcggatgatagaaccacctgtagaacctttaaaa
tgttctgaatttgctgacgtcatcatcaaatatttcagttaa

DBGET integrated database retrieval system