KEGG   'Nostoc azollae' 0708: Aazo_1696Help
Entry
Aazo_1696         CDS       T01260                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00620  Pyruvate metabolism
naz00680  Methane metabolism
naz00710  Carbon fixation in photosynthetic organisms
naz01100  Metabolic pathways
naz01120  Microbial metabolism in diverse environments
naz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aazo_1696
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_1696
   00680 Methane metabolism
    Aazo_1696
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Aazo_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADI63847
UniProt: D7E550
LinkDB All DBs
Position
complement(1758379..1761432)
Genome map
AA seq 1017 aa AA seqDB search
MGSLLYSSSPAVNLYPSELFLRHRLQVVEELWESVLRQECGQKMVDLLGQLRDLCSPEGQ
ATHDQTASAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLTRYSDSGTINQE
HLANIIYSTNQREDDLPVTKELGADSLSQSWTDTTPIKQKGTFAALFPLLFKLNVPPQQI
QRLISQLDIRLVFTAHPTEIVRHTIRDKQRQVVDLLQHLDSLQNRSGGYPWEAQEVKERL
LEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRLKYSLEQTFPWLEPP
SKNFCSFGSWVGSDRDGNPSVTPEVTWKTACYQRKMVLGRYIQSVKQLIELLSVSMQWSD
VLPDLLESLELDQSTMSDVYDALALRYRQEPYRLKLAYVLRRLENTRDHNLALYSRERPA
NEDSPMYRSGAEFLSELRLVQRNLTETGLSCRELENLICQVEIFDFNLTQLDIRQESSRH
CDALNEILEYLQVLPLSYNQLSEAQRVSWLTGELQTRRPLIPGELPFSEKTNDVIETFRV
VRSLQQEFGINICQTYIISMCREVSDVLEVLLLAKEARLFDPAIAVGSIRVVPLFETVED
LQRSRSVMKKLFELPLYRAFLAGGYEALNSENTPPDTQPPNSPSSPTLNPNLQEVMLGYS
DSNKDSGFLSSNWEIHKAQKSLQKIAEQYGLHLRIFHGRGGSVGRGGGPAYEAILAQPGN
SINGRIKITEQGEVLASKYSLLDLALYHVETITTAVVQASLLRTGFDDIEPWNEIMEELS
MRSRQHYRGLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFS
WTQTRFLLPSWYGLGTALQEFLNEQPEEHLKLLRYFYVKWPFFKMAISKAEMTLAKVDIE
MAHHYVQELSNPEDKAQFDKVFEQIASEFYLTRDLVLNITGHQRLLDGDPILQRSVQLRN
GTIVPLGFIQVSILKRLRQYKNTTTSGVINSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcttcatccccagcagtgaatctttacccctcggaattattc
ttgcgtcatcgtctacaggtagtagaggaattgtgggagtcagttcttcggcaagaatgt
ggtcaaaagatggtagatctattgggacaattgcgcgatttgtgttccccagaaggacaa
gctactcatgaccaaaccgcctctgctgtggagttaattgaacaactgaatatcaacgag
gctattcgtgctgctcgtgcttttgctctttattttcagttgattaatatcatagagcag
gaatacgaacaaaagcagcagttaactcgctattctgattcaggcacaatcaatcaggaa
catctcgccaatattatttattccactaaccaaagagaagacgatttacctgtaactaag
gaactaggagcagattccctatcacaaagttggacagacactacgccaattaaacaaaaa
ggcacatttgcggcattatttcccctgttgtttaaactgaatgtaccaccccagcaaatt
caacggttgatttctcaactagatattcgcttggttttcacggcgcaccccacggaaatt
gtccgtcatacgatccgagataaacagcgacaggtagtagacctcttgcaacatctggat
agcttgcaaaatcgttctggtggctatccttgggaagctcaagaagtgaaagagcgttta
ttggaagaaatccgcctgtggtggcgtacagatgaactgcaccagttcaaaccaacggtg
ctggatgaagtagattatgctctgcactatttccaagaagtcttatttgatggtattccc
caactgtataaacgtctcaaatattccctagaacaaacatttccttggttagaaccacca
agtaaaaatttctgttcctttggttcttgggtaggttcagatagggatggaaatccgtca
gtgacaccagaagttacatggaaaacagcttgttatcagcggaaaatggtgttgggaaga
tatattcagtcggtgaagcagctgattgaattattaagtgtgtccatgcagtggagtgat
gtgttgccagatttgctggagtcactggagttagatcagtctacgatgagtgatgtatat
gatgctctggcgttgcgctatcgtcaagaaccatatcgcttaaagttggcctatgtgctg
agaagattggaaaatacacgcgatcacaatctggctttatatagtcgagaaagaccagca
aatgaagattcccccatgtatcgttcaggggctgaatttttatcagaactgcggttggtt
caacgcaatttgacagaaacgggtttaagctgtcgagagttagaaaatctcatatgtcaa
gtggaaatttttgactttaacctgactcagctagatattaggcaagaatcatctcgtcat
tgtgatgcactgaatgagattctcgaatacctgcaagttttacccctatcttataaccaa
ctatcagaagctcaaagagtgtcttggttaactggggaactgcaaacaagacggccgtta
attcctggagagttgccattttcagaaaaaaccaatgatgtaattgaaaccttccgagtt
gtgcgatcactacaacaagaatttggcatcaacatctgtcaaacttacattatcagtatg
tgccgggaagtcagcgatgttttggaagttctgctcttagccaaagaagccagactattt
gatccagcgatcgctgtaggttcaattagagtcgtcccactatttgagactgtagaagac
ttacaacgctctagaagcgtgatgaaaaaactttttgaactccccctatatcgcgccttc
ttagctggtggctatgaagcacttaactccgaaaatactcccccagatacccaaccaccc
aactctccatcttcacccaccctgaaccccaacttgcaagaagtgatgctggggtattct
gacagtaataaggattctggtttcttaagcagcaactgggaaattcacaaagcccaaaaa
tcactccagaaaattgccgaacaatatggcttacacctgcggattttccacggacgcggc
ggttctgtaggtcggggtggtggccctgcttatgaagcgattttggctcaacctggtaac
agtattaatggacgcatcaagattactgaacaaggagaagttttagcttctaaatattcc
ttgctggacttggctttatatcatgtagaaaccatcacaactgcggtagttcaagctagt
ttgttgcggacagggtttgatgatattgaaccatggaatgagatcatggaagaattgtca
atgcgatcgcgccaacattatcgcggtctaatttacgaacaacccgattttatcgacttc
ttccaccaagtcacccccattgaagaaatcagccaactgcaaattagttcgcgtccagcg
cgacgaccatcgggtaaaaaagatttaagcagtttgcgcgctattccttgggtattcagc
tggacacaaacccgattcttgttaccttcttggtatggcttaggtacagctttacaagag
ttcttgaacgaacagccagaagaacacctgaaattgctgcgctatttttatgttaaatgg
cctttcttcaaaatggcaatttctaaagcggaaatgaccttggcaaaagtagacattgaa
atggcacatcattacgtccaggaactatccaacccagaagacaaagcccagtttgataaa
gtatttgagcaaattgctagtgaattttatctaactagagatttggtcttaaatatcact
ggacaccaacgacttttagacggtgatcccatcttgcaacgttccgtacaattacgtaat
gggacaattgtgccattaggatttatacaagtttctatcctgaagcgtttgagacagtac
aaaaacaccacgacctctggagtaattaactcccgttacagcaaaggagagttgcttaga
ggagcattattaaccattaacggtattgctgcaggaatgagaaatacaggttga

DBGET integrated database retrieval system