KEGG   'Nostoc azollae' 0708: Aazo_2058Help
Entry
Aazo_2058         CDS       T01260                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00020  Citrate cycle (TCA cycle)
naz00620  Pyruvate metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
Module
naz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_2058
   00020 Citrate cycle (TCA cycle)
    Aazo_2058
   00620 Pyruvate metabolism
    Aazo_2058
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Aazo_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADI64108
UniProt: D7DWT5
LinkDB All DBs
Position
complement(2137205..2138242)
Genome map
AA seq 345 aa AA seqDB search
MVQERTLPTFNSATVQITKVEGLRLYEDMTLGRFFEDKCAEMYYRGKMFGFVHLYNGQEA
VSTGIIQGAMRPGEDFVSSTYRDHVHALSSGVPAREVMAELFGKATGCSKGRGGSMHMFS
AEHRLLGGYAFVAEGIPVAAGAAFQSKYRREVLGDKNADQVTACFFGDGAANNGQFFETL
NMAALWKLPILFVVENNKWAIGMAHDRATSDPEIHKKASVFNMVGVEVDGMDVLAVRQVA
QEAVARARAGEGPTLIEAMTYRFRGHSLADPDELRSKEEKEYWFSRDPIKKLATYLVEQN
LATGEELKAIEKKIQEVIDEAVKFAESSPEPDASELYRFIFAEDE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagaacgcacattacccacattcaactctgccaccgtccaaattaccaaagta
gaagggttgcggttatacgaagatatgacattagggcggttttttgaagacaaatgcgcc
gaaatgtactacagaggcaaaatgtttggttttgtccacctgtacaacggtcaagaagcc
gtttccacaggtattattcaaggagcaatgcgcccaggggaagacttcgtttccagtacc
taccgtgaccatgttcatgctttgagttcaggtgtaccagccagagaagtcatggcagaa
ctatttggtaaagccacaggttgcagcaaagggcgcggtggttccatgcatatgttttca
gccgaacaccgtttattaggtggttatgctttcgtagctgaaggtattcctgttgcggct
ggtgcagcatttcaaagcaaatatcgccgggaagtattaggagacaaaaacgccgaccaa
gtaaccgcttgtttctttggtgacggcgctgctaacaacggtcaatttttcgagacatta
aatatggcagcgttatggaaattaccaatcttatttgtggtagaaaataataaatgggcg
atcggcatggcacacgatcgcgccacatcagatcccgaaattcacaaaaaagccagcgtg
tttaacatggtaggggtagaagtagatggaatggacgttttagcagttcggcaagtcgcc
caagaagctgtagcccgcgctcgtgcaggagaaggacccaccctcatcgaagccatgacc
tatcgcttccgtggtcactccctagctgacccagatgaactccgcagtaaagaagaaaaa
gaatattggttttctcgtgacccaattaaaaaattagccacttatttagtagaacaaaac
ctcgctacaggagaagaactcaaagctattgagaagaaaattcaggaagttatcgacgaa
gcagtcaaattcgccgaaagcagccctgaaccagatgccagcgaattatatcgcttcatc
tttgcagaagacgagtaa

KEGG   'Nostoc azollae' 0708: Aazo_4540Help
Entry
Aazo_4540         CDS       T01260                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00020  Citrate cycle (TCA cycle)
naz00620  Pyruvate metabolism
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
Module
naz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:naz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_4540
   00020 Citrate cycle (TCA cycle)
    Aazo_4540
   00620 Pyruvate metabolism
    Aazo_4540
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Aazo_4540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADI65806
UniProt: D7DX87
LinkDB All DBs
Position
complement(4629744..4630727)
Genome map
AA seq 327 aa AA seqDB search
MAETLFFNALREAIDEEMARDSSVFLLGEDVGHYGGSYKVTKDLCKKYGDLRVLDTPIAE
NSFTGIAVGAAMTGLRPIIEGMNMGFLLLAFNQISNNAGMLRYTSGGNFKIPMVIRGPGG
VGKQLGAEHSQRLEAYFLAVPGLKIVACSTPYNAKGLLKAAIRDDNPVLFFEHVLLYNLK
ENLPEKEYVLPLDKAEVVRRGKDVTIITYSRMRYHVTQAVETLEKQGYNPEVIDLISLKP
LDFDTIAASVRKTHRVVIVEECMRTGGIGAELTASINDSLFDELDAPVLRLSSQDIPTPY
NGNLERLTIVQPEQIIEAVQKMVALRV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacactatttttcaacgccctgcgggaagccattgatgaagaaatggcgcgt
gactctagcgtatttcttcttggtgaagacgtaggacattacggcggttcttataaagtt
accaaagacctatgcaaaaagtatggtgatctgcgtgtattagatacacccattgcggaa
aacagctttactggtatagcagtaggagcagcaatgactggtctaagacctatcattgaa
ggtatgaatatgggctttttgcttctagccttcaaccaaatttctaataacgcgggtatg
ttgcgctacacttccggcggtaactttaaaatcccgatggtcattcgtggtcctgggggt
gtgggaaaacagttaggtgcagaacattcccaacgtttagaagcttatttcctagctgtt
ccagggttgaaaatcgtagcttgttccacaccttacaacgctaaagggttactgaaagca
gctatccgtgatgataacccagtcttattttttgaacacgttttactctacaacttaaaa
gaaaatctgccagaaaaagagtatgtattaccactggataaagcagaagtagtccgtcgt
ggtaaagacgtgacaattatcacctactcccggatgcgttatcacgtcacgcaagcggta
gaaactttggaaaaacaaggatacaatccagaagttattgacttgatatctctcaagcct
ctagattttgataccattgctgcatccgtgcgtaaaactcaccgtgtagttattgtggaa
gagtgtatgcgaactggtggtattggtgcagagttaacagcctccatcaatgacagcttg
tttgatgaattagacgcacctgtactgcggctttcttcccaagatatccccacaccttac
aacggtaatctggaacgattgactattgttcaaccagagcaaattatcgaagctgtacag
aaaatggtagctttgcgagtttag

DBGET integrated database retrieval system