KEGG   'Nostoc azollae' 0708: Aazo_2358Help
Entry
Aazo_2358         CDS       T01260                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00053  Ascorbate and aldarate metabolism
naz00071  Fatty acid degradation
naz00280  Valine, leucine and isoleucine degradation
naz00310  Lysine degradation
naz00330  Arginine and proline metabolism
naz00340  Histidine metabolism
naz00380  Tryptophan metabolism
naz00410  beta-Alanine metabolism
naz00561  Glycerolipid metabolism
naz00620  Pyruvate metabolism
naz00625  Chloroalkane and chloroalkene degradation
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_2358
   00053 Ascorbate and aldarate metabolism
    Aazo_2358
   00620 Pyruvate metabolism
    Aazo_2358
  Lipid metabolism
   00071 Fatty acid degradation
    Aazo_2358
   00561 Glycerolipid metabolism
    Aazo_2358
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aazo_2358
   00310 Lysine degradation
    Aazo_2358
   00330 Arginine and proline metabolism
    Aazo_2358
   00340 Histidine metabolism
    Aazo_2358
   00380 Tryptophan metabolism
    Aazo_2358
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aazo_2358
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aazo_2358
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aazo_2358
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Aazo_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADI64309
UniProt: D7DXY1
LinkDB All DBs
Position
2451062..2452447
Genome map
AA seq 461 aa AA seqDB search
MITLQSKNYMEIINKQRDFFKKGKTKDVGFRLTQLKKLKQLITENQEAIIKTLAADLNKP
EFESYATEIGSIKEIDYAIKNISNWTKPKKVAVSWDLFPYSAKIYPEPLGLVLIIGPWNY
PFQLIISPLVGAITAGNCSIIKPSELAPHTSRLASQLISEYFPSEYITVLQGGVETSQQL
LAEKFDHIFFTGGTAIGKIVMEAAAKHLTPVTLELGGKTPCIVDTEINLEHTIKRITWGK
FINAGQTCIAPDYLLVNKKIKPYLVSRIKKCLQEFYGDNPATSPDFARIISKKHFDRLAK
FLQCGEIIAGGETNPEELYIAPTLLDHISLADPVMEEEIFGPILPIIEYTEIDEAISVIN
SKPKPLALYLFSDNKNLQQQILQATSSGSMCINDTVMQVAVSSLPFGGVGDSGIGSYHGK
ASFDTFSHYKSVLKNTFRLDINWRYAPYQGKLPLLKKIIGA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgattactcttcaatcaaaaaactacatggaaattatcaataaacaacgtgatttcttt
aaaaaaggtaaaactaaagatgtaggttttcgattaacacaacttaaaaaactaaaacag
ctaattactgaaaatcaagaagccatcattaaaaccttagctgcagatttaaacaaacca
gaattcgaaagttatgccacagaaataggttctattaaagaaatagattatgcaattaaa
aatattagtaattggactaaaccgaaaaaggtagcagtttcttgggatttatttccttac
tcagccaaaatttatcctgaaccactaggattggtcttaattattggaccatggaactat
ccatttcagttgattatatctcccttagtcggtgcgatcacagcggggaattgttcaatt
atcaaaccttcagaacttgcaccccacacctcgagattagcatctcaactaattagtgaa
tatttcccatcagaatatattacagttttacaaggaggagtagaaaccagccaacaatta
ctagcagaaaaatttgatcacatcttctttacaggtggtacagccatcggtaaaatcgtc
atggaagcagccgcaaaacatctcaccccagtaaccttagaactaggtggtaaaactcct
tgtatagtcgatacagaaatcaatcttgaacacaccatcaaacgcattacatggggtaaa
tttattaatgctggacaaacttgtattgcacctgactatctattagttaataaaaaaatt
aaaccatatttagtcagtcgtataaaaaaatgtctgcaagaattttatggagataaccca
gcaaccagtcctgattttgccagaattattagtaaaaaacactttgatagattagcaaaa
tttctccaatgtggtgaaattattgctggtggagaaaccaatccagaagaactttatatt
gctcccacattacttgatcatatttccttagcagatcctgtcatggaagaggaaattttt
ggtcctattctgccaatcattgaatatacagagatcgatgaagccattagtgtgattaat
tccaaacccaaacctttagctttatatctattttccgacaataaaaacctacaacagcaa
atcttacaagcaacttcatctggtagtatgtgtatcaatgacacagtaatgcaagtagca
gtttcttcattaccatttggtggagttggtgatagtgggattggtagctatcatggtaag
gccagttttgacaccttttcccattacaaaagtgtcttgaaaaacactttccgtctcgat
attaattggcgttatgccccctatcagggtaaactacctctgttaaagaaaatcattggt
gcttga

DBGET integrated database retrieval system