KEGG   'Nostoc azollae' 0708: Aazo_4281Help
Entry
Aazo_4281         CDS       T01260                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
naz  'Nostoc azollae' 0708
Brite
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Aazo_4281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: ADI65648
UniProt: D7DW77
LinkDB All DBs
Position
complement(4352038..4352637)
Genome map
AA seq 199 aa AA seqDB search
MAFTQLPLPFDFNALEPYGMKGETFEYHYGKHHKAYVDNLNKLTDATELADKSLEEVIQI
SFKDSSKAGIFNNAAQVWNHTFFWNSLKPAGGGTPTGELAARIDKDFGSFDKFKEEFSTA
ATTQFGSGWAWLIDDSGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAFI
KNFLDQLVNWEFAAANLAG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacacagcttcccctaccctttgattttaatgctctagagccttatggcatg
aaaggtgaaacctttgagtatcactatggtaagcatcacaaagcttatgtagataacctc
aacaaactcaccgatgctacagaacttgctgataagtccctcgaagaagtaatccaaatt
tccttcaaagactcctctaaagctggtatcttcaacaacgcggctcaagtttggaaccac
accttcttttggaactcactcaaacccgcaggtggtggcacacccacaggcgaactggct
gctaggattgacaaagattttggtagctttgacaaattcaaagaagaattttctaccgct
gctacaacccagtttggtagcggttgggcttggctgattgatgatagtggcacactcaag
gtgatcaagacacccaacgcagagaaccccctagcccatggtaaaaaggcacttctcacc
ctagacgtttgggaacacgcctactacatcgactacagaaatgctcgtccagcattcatc
aaaaatttcttagatcaattggttaactgggaatttgctgctgcaaatctagctggttaa

DBGET integrated database retrieval system