KEGG   Neisseriaceae bacterium DSM 100970: CUN60_01405Help
Entry
CUN60_01405       CDS       T05482                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nba  Neisseriaceae bacterium DSM 100970
Pathway
nba00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUN60_01405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nba02000]
    CUN60_01405
Enzymes [BR:nba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CUN60_01405
Transporters [BR:nba02000]
 Other Transporters
  Pores ion channels [TC:1]
   CUN60_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_6 GST_C_3 GluRS_N
Motif
Other DBs
NCBI-ProteinID: AUR51014
UniProt: A0A2I7N3I0
LinkDB All DBs
Position
305700..306317
Genome map
AA seq 205 aa AA seqDB search
MSKKLVFYTNPRSRGRIVRWMLEELGINYETKVIEYGAAMKSPEYLAINPMGKVPAIQYG
EEVVTESAAICTYLAETFPDAGLAPLPEEKGNYYRWLFFAAGPLEQATALKGLDINIPAE
KQGMLGFGNFEITLNALSKALMDNPYIAGNRFTAADVYVGLSIGWGMQFGMIEKRSEFVE
YWERISQRPAYLRAQKLDDELIPKA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaattggtgttttatacaaatccaaggtctcgaggtcggattgtccgctgg
atgcttgaagaattgggtattaattatgaaactaaggtgattgagtatggtgctgcaatg
aagtctccagaataccttgctattaatccaatgggtaaagtcccggctattcagtatgga
gaagaggttgtaaccgaaagtgctgcaatatgtacttatctagcggaaacctttcctgat
gcaggtttggcaccgctacctgaagagaaggggaattattatcgctggttattttttgcg
gctggtccactggagcaagctactgcattaaaaggattggatatcaatatccctgctgaa
aaacaaggaatgcttggctttgggaattttgagattaccctaaatgctctttctaaggca
cttatggataacccatatatagctggtaacagattcactgctgctgatgtttatgtcggg
ttaagtattggatggggaatgcaatttggcatgatagagaaacgttcagaatttgtagag
tattgggagcgaatcagtcaacgtccggcttatttacgtgcacaaaaacttgatgatgaa
ttaataccgaaggcataa

DBGET integrated database retrieval system