KEGG   Neisseriaceae bacterium DSM 100970: CUN60_06205Help
Entry
CUN60_06205       CDS       T05482                                 

Definition
(GenBank) hypothetical protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nba  Neisseriaceae bacterium DSM 100970
Pathway
nba00550  Peptidoglycan biosynthesis
nba01100  Metabolic pathways
nba01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUN60_06205
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CUN60_06205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nba01003]
    CUN60_06205
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nba01011]
    CUN60_06205
Enzymes [BR:nba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CUN60_06205
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CUN60_06205
Glycosyltransferases [BR:nba01003]
 Polysaccharide
  Bacterial polysaccharide
   CUN60_06205
Peptidoglycan biosynthesis and degradation proteins [BR:nba01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CUN60_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly DUF726 DUF5442
Motif
Other DBs
NCBI-ProteinID: AUR51905
UniProt: A0A2I7N6R1
LinkDB All DBs
Position
1357342..1357929
Genome map
AA seq 195 aa AA seqDB search
MKIFRGHLLLRILYNWKKLKKSVKEYRQAKFDNEILNLPNHFFDVLLLAEDHRFRRHIGV
DFIALLRSIYKSLIVREKQGGSTIAMQLVRTITNDREQTVFRKVREIVLAIILTSYLNKD
DILIMYMRIAYFGWNMEGLESACIKLKIDINNIEISDAVLLVSRLKYPEPRFENKNQSFK
IYNRINYLYKRFVNR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
attaagatttttagagggcatttattgttgagaatcttatataattggaaaaaactaaaa
aaatcagtcaaagagtatagacaggcaaaatttgataatgagattcttaatttgccaaat
catttttttgatgtgttacttttagccgaagatcaccgctttaggcgccatattggtgtt
gatttcattgcattattaaggtctatatataagagtttaattgttcgcgaaaaacaaggt
ggatcaaccattgcaatgcaacttgtaagaacgataactaatgatagggaacagaccgtc
ttcaggaaagtcagagaaattgtgttggcaataattttaacgtcctatttgaataaagat
gatattttgattatgtatatgcgaatagcttattttggttggaatatggaaggcttagag
tcggcatgtattaaattaaaaattgatataaataatattgaaatttcagacgctgtttta
ttagtttcaagattaaaatatccagagcctagatttgaaaataaaaatcaatctttcaaa
atatacaacagaataaactacttatataaaaggtttgttaatagatga

DBGET integrated database retrieval system