KEGG   Natronorubrum bangense: DV706_12425Help
Entry
DV706_12425       CDS       T05942                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00010  Glycolysis / Gluconeogenesis
nbg00020  Citrate cycle (TCA cycle)
nbg00620  Pyruvate metabolism
nbg01100  Metabolic pathways
nbg01110  Biosynthesis of secondary metabolites
nbg01120  Microbial metabolism in diverse environments
nbg01130  Biosynthesis of antibiotics
nbg01200  Carbon metabolism
Module
nbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DV706_12425
   00020 Citrate cycle (TCA cycle)
    DV706_12425
   00620 Pyruvate metabolism
    DV706_12425
Enzymes [BR:nbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DV706_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding OsmC Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: QCC55205
UniProt: A0A4D6HP10
LinkDB All DBs
Position
complement(2469986..2471794)
Genome map
AA seq 602 aa AA seqDB search
MAYIVRMPKLGLEMERGELLEWRIDAGATVEEGEVIAEVESEKSIAEVEARENGVLRETY
LEEGGTVPPGTPIGIVAPEDADIADLEAEASSDIEEATGETAAEEPAADESAAESADSGP
ASETAAATDTADSEVQASPRARERAAELEVDLSTVEGTGYQGSITEDDVEAAAESGGAAE
ADVNASPRARKRADELGVDLTTVEGTGYQGSITEDDVEDAAGSGDRTPVDTRPFSGMRQT
IAARLGESYREAVHVTVHRKADAEALFDATDAADDALETDVSIQDLLVLAISATLEDHPE
FNATFEDEVHTLWAEHNVGLAVDVEHGLIAPVLRDVGSKSLATIADERRDLVGSALEGEY
TMDDLQGGTFTVTNLGVLGVESFDPVINPPQVAILGVNAISEVPTRGSNDEVEWRRQLPL
DLSFDHRIVDGADAARFLESLVEHLEEPWALLPDEISAGAGTEAGAPTEMPERTVTARNP
DGMAGTIEAGSFEWGYDEPEEAGGTETGPTPVDVFLGSLAACLSLSIRFQAGKRDTPIGA
IDVTTTAEPEHGGVEQLEATVQLESDADDDTLDRLIDLGERGCHVSQLVRDDLEVEISWE
RV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcttatatcgtcaggatgccaaagctgggattggagatggagcgaggcgaactgctc
gagtggcggatcgacgcgggtgcaaccgtcgaggagggcgaggtaatcgcggaagtcgaa
tccgaaaagagcatcgccgaggtcgaggctcgagagaacggcgtcctcagagagacgtat
ctcgaggagggtgggacggtcccacccggcacgccgatcggaatcgtcgcgcccgaagac
gctgatattgccgacctcgaggcggaggcgtcgtctgatatcgaggaggcgaccggcgag
acagcggccgaggagccagcagccgacgaatcggcggccgaaagcgccgacagcggtcca
gcgagcgagacggcagccgcgacggacacggccgacagcgaggtgcaggcctcgccacgg
gctcgcgagcgcgccgctgaactcgaggtcgacctctcgaccgtcgaggggacggggtat
cagggctcgatcaccgaagacgacgtcgaggcggccgccgaatcaggtggggccgccgaa
gcggacgtcaacgcctccccgcgggcacgcaagcgcgccgacgaactcggcgtcgatctg
acgaccgtcgaggggacggggtatcaggggtcgatcactgaagacgacgtggaagatgcg
gccggcagcggcgatcgaacgccggtcgacacacgccccttcagcgggatgcgccagacc
atcgccgcccgcctcggcgagagctatcgggaagccgtgcacgtcacagtccaccgcaag
gccgacgccgaggcgctgttcgacgccaccgacgccgcggacgacgccctcgagaccgat
gtctcgattcaggatctgctcgtgctcgccatctcggcgacgctcgaggaccatcccgaa
ttcaacgcgacgttcgaggacgaggtccacacgctctgggcggaacacaacgtcggtctc
gccgtcgacgtcgaacacgggctgatcgcacccgtgttgcgtgacgtggggagcaagtca
ctcgcaacgatcgccgacgaacggcgcgacctcgttggatcggccctcgagggcgagtac
acgatggacgacctccagggtgggacgtttaccgtgacgaacctcggcgtcctcggcgtc
gagtcgttcgacccggtcatcaacccgccgcaggtcgccatcctcggcgtcaacgcgatt
tcggaggtccccacacgtgggtcgaacgacgaggtggagtggcgacgacagcttccgctc
gatctctctttcgaccaccgcatcgtcgacggggctgacgccgcccgcttccttgagagc
ctcgtcgaacacctcgaggagccatgggcgctgctgcccgatgaaatcagcgccggggcc
ggcacagaagcgggcgcgccaacggagatgcccgagcgcacggtcacggcacgcaacccc
gacggcatggccgggacgatcgaagccggctcgttcgagtggggctacgacgagcccgag
gaggccggcggcaccgaaacggggccgacgccggtcgacgtcttcctcggctcgctcgct
gcgtgtctctcactgagcatccggttccaggccggcaagcgcgacacgccgatcggcgcg
atcgacgtcacgacgacggctgagccagaacacggcggtgtcgaacagcttgaagcgacg
gttcaactcgagtccgatgccgacgacgacacccttgatcgactcattgatctcggcgaa
cggggctgtcacgtctcacagctggttcgagacgatctcgaggtcgaaatcagctgggaa
cgggtctga

DBGET integrated database retrieval system