KEGG   Natronorubrum bangense: DV706_15485Help
Entry
DV706_15485       CDS       T05942                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DV706_15485
Enzymes [BR:nbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DV706_15485
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DV706_15485
    1.1.1.-  
     DV706_15485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: QCC55745
UniProt: A0A4D6HQJ8
LinkDB All DBs
Position
complement(3077993..3079060)
Genome map
AA seq 355 aa AA seqDB search
MRSAVFHGRENIQVDEIAEPVVERDSVLIDVIAAGICGSDLHEYAAGPIFIPGDAPHPVT
GETAPVSMGHEFGGEVIEIGDDVEDIAVGDTVTVNPILYCGECRYCEDGSYHLCESGGFI
GLSGGGGGFSEQIAVSSEQAIPVPDDVPAEYAALVEPFSVGLHAVRNAEFSAGDSVAVYG
TGPIGLTVIQAAKAAGANPVYAIEPQDARRELAAEVGADMTFNPIDTDAPEAIIEQSDGG
VDATFEVAGIEQTVRDAIRSVKNDGSVTIVSIFEESVEIEPNEIVLGERTVSGTLAYEGG
PNSDVEFGAVIDMFADETLDPEPLITSRIGLEEIVDGFDTLLGGEHDEIKIIVEP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgccgtattccatggacgagagaacatccaggtcgatgagatcgccgaaccg
gtcgtcgagcgcgacagtgtcctgatcgatgtcatcgcggcagggatctgtgggtcggac
ctgcatgagtacgctgccggcccgattttcattcctggcgatgccccacatccagtaact
ggagaaacagcccccgtctcgatgggccacgagttcggcggcgaagtcatcgagatcggt
gacgacgtcgaggatatcgccgtcggcgacaccgtcaccgtcaacccgattctgtactgc
ggcgagtgtcggtactgcgaggacggttcgtaccacctctgtgagtctggcggtttcatc
ggcctctccggcggcggtggcggtttctctgaacagatcgccgtctcgagcgagcaggcg
attccggttcccgacgacgtgccggccgagtacgccgcgctggtcgaaccgttcagtgtc
ggcctacatgccgtaagaaacgcggagttttccgccggcgattcggtcgccgtctacggc
actggcccgatcgggctgaccgtcattcaggcggcgaaagccgccggtgcgaatccggtg
tatgccatcgagccccaggatgcacgacgggagctggctgccgaagtcggtgcggatatg
acgttcaacccgatcgacacggacgcccccgaagcgatcatcgagcagtcagacggtggc
gtcgatgcgacgttcgaagtcgccgggatcgaacagacggttcgggacgcgatccgatcg
gtgaaaaacgacggatcggtcaccatcgtcagcatcttcgaagagagcgtcgaaatcgag
ccaaacgaaatcgtcctcggcgaacgcaccgtttctgggacgttggcgtacgaaggcggc
cccaacagtgacgtggagttcggtgccgtcatcgacatgttcgccgacgagacactcgat
cctgagccgcttatcaccagccgaatcgggctcgaggagatcgtcgacggcttcgatacg
ctgctcggcggcgagcacgacgagatcaagattatcgtcgaaccctag

DBGET integrated database retrieval system