KEGG   Nocardia brasiliensis: O3I_005520Help
Entry
O3I_005520        CDS       T02270                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00564  Glycerophospholipid metabolism
nbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    O3I_005520
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     O3I_005520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA Pyr_redox Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFT99066
UniProt: K0ENR8
LinkDB All DBs
Position
1280800..1282566
Genome map
AA seq 588 aa AA seqDB search
MTKKPESQFLGPEQRRTAWERFGKDHFDVVVIGGGVVGAGIALDAATRGLQVALVEARDL
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELALSTLAPHLVKPLRFLYPLTHRAW
ERPYVAAGLVLYDTMGGAKSVPGQRHLSRMGALRLSPGLKRSALIGGVSYYDTVVDDARH
TMTVARTAAHYGAVIRTSTQVVGFLREADRVVGVRVRDSEDGRTAEVRAHVVINATGVWT
DEVQALAHQRGRFHVRASKGVHIVVPRDRIVSDAAIILRTPTSVLFIIPWGTHWIVGTTD
TDWNLDLAHPAATKADIDYLLDRVNEVLVTPLTHDDIDGVYAGLRPLLAGESDETSKLSR
EHAVARVAPGLVGIAGGKYTTYRVMAYDAVDEAAQDIPARVSPSITEKVPLLGADGYFAL
VNQTVQLAEAYGVHPYRVKHLLDRYGSLIDEVMAMADGKPELLQPITDAPSYLQVEAVYA
AAAEGALHLDDILARRTRISIEYSHRGADCAEEVAQLVAPVLGWDDAEIDREVTTYRARV
EAEIRSQTQPDDASADALRIAAPEPRPEILEPVPADGSASKAVRQPNS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagccggaatcccagttcctcggtccggagcagcgcaggacggcctgggaa
cggttcggtaaggaccatttcgacgtggtcgtcatcggtggtggcgtggtcggcgcgggt
atcgccctggacgcggccacccgcggcctgcaggtcgcgctggtcgaggcccgtgacctc
gcctccggcacgtcgagccggtcgtcgaagatgttccacggcggcctgcgctatctggag
cagttggagttcggcctggtgcgcgaggcgttgcgcgagcgcgagctggcgctgtccacg
ctggcgccgcatctggtgaaaccactgcggttcctctacccgctcacccatcgcgcctgg
gaacgcccgtacgtggcggccgggctggtgctctacgacaccatgggcggcgccaaatcg
gttcccggtcaacggcatctgtcccggatgggggcgctgcggctgtcgcccggactcaag
cgcagcgcgctgatcggcggcgtcagctactacgacaccgtcgtcgacgacgcccggcac
accatgacggtggcgcgtaccgccgcgcactacggggcggtgatccgcacctccacccag
gtggtcggcttcctacgggaggcggatcgggtggtcggcgtgcgggtgcgcgacagcgag
gacggccgcaccgcggaggtgcgggcgcacgtggtgatcaacgcgaccggcgtgtggacc
gacgaggtgcaggcgctggcgcatcagcggggccggttccacgtgcgcgcgtcgaagggc
gtgcacatcgtggtgccgcgggaccggatcgtcagcgatgccgcgatcatcctgcgcacg
ccgacctcggtgctgttcatcatcccgtggggcacccactggatcgtcggcaccaccgac
accgactggaatctcgatctcgcgcatccggccgctaccaaggccgatatcgactatctg
ctcgaccgggtcaacgaggtgctggtcaccccgctcacccacgacgacatcgacggggtc
tacgcggggctgcggccgctgctggcgggggagagcgacgagacctccaagctgtcgcgc
gaacatgccgtggcccgggtcgcgcccgggctggtcggcatcgcgggcggtaagtacacc
acctaccgggtgatggcctacgacgcggtcgacgaggcggcacaggacattccggcccgg
gtttcgccctcgatcaccgagaaggtgccgctgctcggcgcggacggctatttcgcgctg
gtcaatcagacggtgcagctggccgaggcctacggcgtgcacccgtatcgggtcaagcat
ctgctcgaccgctacggctcgctgatcgatgaggtgatggccatggcggacggcaaaccg
gaactgctgcaaccgatcaccgacgcaccatcgtatctgcaggtggaggccgtctacgcg
gccgcggccgagggcgcgctgcacctggacgacatcctggcccggcgcacccggatctcc
atcgagtactcccatcgcggcgccgactgcgccgaggaggtggcgcagctggtcgccccg
gtcctcggctgggacgacgccgaaatcgaccgtgaggtaacgacttaccgggcgcgggtc
gaggcggagatccgctcgcagacccagcccgacgacgcctcggcagacgcgttgcgcatc
gcggcgcccgaaccgcggccggagatcctggagccggtgccggccgacggctcggcgagc
aaggctgtgcggcaaccgaattcgtag

DBGET integrated database retrieval system